Potri.004G147966 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G148100 134 / 4e-43 ND /
Potri.009G109200 119 / 6e-37 ND /
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10021010 42 / 9e-06 ND /
Lus10023840 37 / 0.0007 AT1G50030 239 / 2e-62 target of rapamycin (.1.2)
PFAM info
Representative CDS sequence
>Potri.004G147966.1 pacid=42796425 polypeptide=Potri.004G147966.1.p locus=Potri.004G147966 ID=Potri.004G147966.1.v4.1 annot-version=v4.1
ATGTCAGGACTTGTGGACATTTGGACTGGCGAGCTTGCCAAGCTACGTGAAAAGGGTCAGGCTGTTTGGTCAAGTGGCTCGAGCCCTACAAATGTTGAGT
CAAGTAAAGTGGTTCCAGGAGAGGAAGGAAGCTTACGCTTGGTAAAGCCATTGCCTGCTTCAATCAGAGGCATGCGAGTCAAGTCACCTGCATTGACATA
TTCTGAGGCTTCACTTTCCATGCTTGTCGACTGCTTGAATCAATGA
AA sequence
>Potri.004G147966.1 pacid=42796425 polypeptide=Potri.004G147966.1.p locus=Potri.004G147966 ID=Potri.004G147966.1.v4.1 annot-version=v4.1
MSGLVDIWTGELAKLREKGQAVWSSGSSPTNVESSKVVPGEEGSLRLVKPLPASIRGMRVKSPALTYSEASLSMLVDCLNQ

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.004G147966 0 1
AT4G10270 Wound-responsive family protei... Potri.013G148000 3.00 0.9889
AT1G80440 Galactose oxidase/kelch repeat... Potri.001G178300 5.09 0.9637
AT1G03220 Eukaryotic aspartyl protease f... Potri.019G065100 6.00 0.9667
Potri.010G225900 6.32 0.9950
AT1G58420 Uncharacterised conserved prot... Potri.002G117100 6.92 0.9509
AT5G45160 Root hair defective 3 GTP-bind... Potri.012G117067 7.48 0.9950
AT3G29970 B12D protein (.1) Potri.004G117300 8.12 0.9729
AT1G03230 Eukaryotic aspartyl protease f... Potri.019G064800 8.36 0.9601
AT5G25940 early nodulin-related (.1) Potri.009G143800 9.38 0.9327
AT5G54165 unknown protein Potri.012G021602 10.19 0.9196

Potri.004G147966 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.