Potri.004G151650 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G152201 244 / 2e-85 ND /
Potri.001G164100 0 / 1 AT1G72440 972 / 0.0 SLOW WALKER2, embryo sac development arrest 25, CCAAT-binding factor (.1)
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.004G151650.1 pacid=42794006 polypeptide=Potri.004G151650.1.p locus=Potri.004G151650 ID=Potri.004G151650.1.v4.1 annot-version=v4.1
ATGCTCATACTCAAGACCTGCAAATGGGGATGCGCCTGCAGTTTTCTATTTCGTTCGTCAAAACCACTGAAAACATCATTTGTCAAGATCTTTTCCCTCT
GCATCACCGATATCACAAGCCGAGTCCGTCATCATCTTCATTCACAGCTTGTTCCAAATCATCACGGTAATATCTGGTTCCCGCTTCAAGAGACAGATCG
GCAGAGTCTAAAGGATTATCAATCTCTTCACTATCGCTCTCTGCATCACACTCTTCAGCTGCCTTCTTTTTCTTCTTCTTTGGCTTTGAGGTATTCATTT
CATTCACATAAAAAATGCGGAAGACGAGATATTCTGGAGGCACATCAGTTCATGAAAGAATTTTGA
AA sequence
>Potri.004G151650.1 pacid=42794006 polypeptide=Potri.004G151650.1.p locus=Potri.004G151650 ID=Potri.004G151650.1.v4.1 annot-version=v4.1
MLILKTCKWGCACSFLFRSSKPLKTSFVKIFSLCITDITSRVRHHLHSQLVPNHHGNIWFPLQETDRQSLKDYQSLHYRSLHHTLQLPSFSSSLALRYSF
HSHKKCGRRDILEAHQFMKEF

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.004G151650 0 1
AT5G64290 DCT, DIT2.1 dicarboxylate transport 2.1 (.... Potri.001G310600 15.03 0.9359
AT2G18420 Gibberellin-regulated family p... Potri.013G113400 20.78 0.9352
AT4G00165 Bifunctional inhibitor/lipid-t... Potri.014G059800 25.51 0.9348
AT4G18550 AtDSEL Arabidopsis thaliana DAD1-like... Potri.004G054600 29.18 0.9348
AT5G51810 AT2353, GA20OX2... gibberellin 20 oxidase 2 (.1) Potri.007G103800 33.09 0.9342 GA20ox5
AT1G72610 ATGER1, GLP1 A. THALIANA GERMIN-LIKE PROTEI... Potri.003G065266 39.33 0.9341
AT4G33355 Bifunctional inhibitor/lipid-t... Potri.014G046500 43.78 0.9336
Potri.011G073116 46.15 0.9336
Potri.014G075251 48.40 0.9336
AT2G20870 cell wall protein precursor, p... Potri.013G144200 50.91 0.9334

Potri.004G151650 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.