Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G38970 66 / 7e-14 ATBR6OX, CYP85A1, BR6OX1 brassinosteroid-6-oxidase 1 (.1.2.3) AT5G05690 62 / 1e-12 CBB3, DWF3, CYP90A1, CYP90A, CPD DWARF 3, CYTOCHROME P450 90A1, CONSTITUTIVE PHOTOMORPHOGENIC DWARF, CABBAGE 3, Cytochrome P450 superfamily protein (.1.2.3) AT3G30180 61 / 3e-12 CYP85A2, BR6OX2 brassinosteroid-6-oxidase 2 (.1) AT3G44970 61 / 4e-12 Cytochrome P450 superfamily protein (.1) AT1G78490 57 / 1e-10 CYP708A3 "cytochrome P450, family 708, subfamily A, polypeptide 3", cytochrome P450, family 708, subfamily A, polypeptide 3 (.1) AT3G30290 56 / 2e-10 CYP702A8 "cytochrome P450, family 702, subfamily A, polypeptide 8", cytochrome P450, family 702, subfamily A, polypeptide 8 (.1) AT4G15393 56 / 2e-10 CYP702A5 "cytochrome P450, family 702, subfamily A, polypeptide 5", cytochrome P450, family 702, subfamily A, polypeptide 5 (.1.2.3) AT1G12740 56 / 3e-10 CYP87A2 "cytochrome P450, family 87, subfamily A, polypeptide 2", cytochrome P450, family 87, subfamily A, polypeptide 2 (.1.2) AT5G48000 55 / 4e-10 THAH1, THAH, CYP708A2 THALIANOL HYDROXYLASE 1, THALIANOL HYDROXYLASE, "cytochrome P450, family 708, subfamily A, polypeptide 2", cytochrome P450, family 708, subfamily A, polypeptide 2 (.1.2.3.4.5) AT1G55940 54 / 9e-10 CYP708A1 "cytochrome P450, family 708, subfamily A, polypeptide 1", cytochrome P450, family 708, subfamily A, polypeptide 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G143600 [exp] 75 / 5e-17 AT1G12740 475 / 3e-165 "cytochrome P450, family 87, subfamily A, polypeptide 2", cytochrome P450, family 87, subfamily A, polypeptide 2 (.1.2) Potri.002G010532 [exp] 69 / 1e-16 AT1G12740 132 / 1e-37 "cytochrome P450, family 87, subfamily A, polypeptide 2", cytochrome P450, family 87, subfamily A, polypeptide 2 (.1.2) Potri.009G064900 [exp] 72 / 3e-16 AT1G12740 477 / 5e-166 "cytochrome P450, family 87, subfamily A, polypeptide 2", cytochrome P450, family 87, subfamily A, polypeptide 2 (.1.2) Potri.001G270800 [exp] 72 / 6e-16 AT1G12740 488 / 2e-170 "cytochrome P450, family 87, subfamily A, polypeptide 2", cytochrome P450, family 87, subfamily A, polypeptide 2 (.1.2) Potri.004G183800 [exp] 72 / 7e-16 AT1G12740 476 / 1e-165 "cytochrome P450, family 87, subfamily A, polypeptide 2", cytochrome P450, family 87, subfamily A, polypeptide 2 (.1.2) Potri.001G270700 [exp] 70 / 2e-15 AT1G12740 455 / 1e-157 "cytochrome P450, family 87, subfamily A, polypeptide 2", cytochrome P450, family 87, subfamily A, polypeptide 2 (.1.2) Potri.004G204100 [exp] 70 / 2e-15 AT1G12740 468 / 9e-163 "cytochrome P450, family 87, subfamily A, polypeptide 2", cytochrome P450, family 87, subfamily A, polypeptide 2 (.1.2) Potri.001G109100 [exp] 69 / 4e-15 AT1G12740 770 / 0.0 "cytochrome P450, family 87, subfamily A, polypeptide 2", cytochrome P450, family 87, subfamily A, polypeptide 2 (.1.2) Potri.001G270400 [exp] 69 / 8e-15 AT1G12740 442 / 2e-152 "cytochrome P450, family 87, subfamily A, polypeptide 2", cytochrome P450, family 87, subfamily A, polypeptide 2 (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028628 [exp] 82 / 2e-19 AT1G12740 360 / 9e-121 "cytochrome P450, family 87, subfamily A, polypeptide 2", cytochrome P450, family 87, subfamily A, polypeptide 2 (.1.2) Lus10042788 [exp] 80 / 9e-19 AT1G12740 397 / 1e-134 "cytochrome P450, family 87, subfamily A, polypeptide 2", cytochrome P450, family 87, subfamily A, polypeptide 2 (.1.2) Lus10027434 [exp] 69 / 5e-15 AT1G12740 342 / 3e-113 "cytochrome P450, family 87, subfamily A, polypeptide 2", cytochrome P450, family 87, subfamily A, polypeptide 2 (.1.2) Lus10030404 [exp] 68 / 1e-14 AT5G05690 531 / 0.0 DWARF 3, CYTOCHROME P450 90A1, CONSTITUTIVE PHOTOMORPHOGENIC DWARF, CABBAGE 3, Cytochrome P450 superfamily protein (.1.2.3) Lus10014850 [exp] 68 / 2e-14 AT5G05690 679 / 0.0 DWARF 3, CYTOCHROME P450 90A1, CONSTITUTIVE PHOTOMORPHOGENIC DWARF, CABBAGE 3, Cytochrome P450 superfamily protein (.1.2.3) Lus10024495 [exp] 66 / 8e-14 AT1G12740 751 / 0.0 "cytochrome P450, family 87, subfamily A, polypeptide 2", cytochrome P450, family 87, subfamily A, polypeptide 2 (.1.2) Lus10017839 [exp] 65 / 2e-13 AT1G12740 640 / 0.0 "cytochrome P450, family 87, subfamily A, polypeptide 2", cytochrome P450, family 87, subfamily A, polypeptide 2 (.1.2) Lus10028297 [exp] 64 / 2e-13 AT5G05690 472 / 2e-168 DWARF 3, CYTOCHROME P450 90A1, CONSTITUTIVE PHOTOMORPHOGENIC DWARF, CABBAGE 3, Cytochrome P450 superfamily protein (.1.2.3) Lus10040193 [exp] 64 / 4e-13 AT5G05690 687 / 0.0 DWARF 3, CYTOCHROME P450 90A1, CONSTITUTIVE PHOTOMORPHOGENIC DWARF, CABBAGE 3, Cytochrome P450 superfamily protein (.1.2.3) Lus10000647 [exp] 64 / 6e-13 AT3G30180 540 / 0.0 brassinosteroid-6-oxidase 2 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.004G151800.2 pacid=42794424 polypeptide=Potri.004G151800.2.p locus=Potri.004G151800 ID=Potri.004G151800.2.v4.1 annot-version=v4.1 ATGAAAAAAAGAAAAGAAAAAGGCGAGGATAGAAGGAAAAATCACTTGTCCCACTGGACGATCACCGCAACTTCAAGTGTGGCCATCAAGTTACTGGCAG AGCATGCTCTTGTTATGCAAGAATTAGTGGTTATCAATGAAGCCCTACGGATTAGTGGTGGAGTTGGGATCCTAAGAAGAACAAAACAAGACATTCAAGT AAACGGATACACGATTCCAAAAGACTGGTCAGTTTTTCTCTTCTCATCTGCAGTTTTCATGAATCCAGACATATATAAAGACCATCTTGCCTTCAATCCA TGGTGA
AA sequence Show only first row Show all	>Potri.004G151800.2 pacid=42794424 polypeptide=Potri.004G151800.2.p locus=Potri.004G151800 ID=Potri.004G151800.2.v4.1 annot-version=v4.1 MKKRKEKGEDRRKNHLSHWTITATSSVAIKLLAEHALVMQELVVINEALRISGGVGILRRTKQDIQVNGYTIPKDWSVFLFSSAVFMNPDIYKDHLAFNP W

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G38970		ATBR6OX, CYP85A...	brassinosteroid-6-oxidase 1 (....		Potri.004G151800 [exp]	0	1
AT5G58060		ATYKT61, ATGP1,...	SNARE-like superfamily protein...		Potri.006G187700 [exp]	1.00	0.9253
AT5G36110		CYP716A1	"cytochrome P450, family 716, ...		Potri.006G085500 [exp]	2.44	0.8898	CYP716A8
AT1G19430			S-adenosyl-L-methionine-depend...		Potri.002G260600 [exp]	2.82	0.9006
					Potri.015G112801 [exp]	6.92	0.8567
AT1G07980	CCAAT	NF-YC10	"nuclear factor Y, subunit C10...		Potri.009G012300 [exp]	9.48	0.8415
AT4G33640			unknown protein		Potri.007G116400 [exp]	10.48	0.8567
AT3G12260			LYR family of Fe/S cluster bio...		Potri.001G029900 [exp]	12.64	0.8724
AT1G02040	C2H2ZnF		C2H2-type zinc finger family p...		Potri.002G143600 [exp]	16.43	0.8639
AT5G45420	MYB	maMYB	membrane anchored MYB, Duplica...		Potri.001G147000 [exp]	16.61	0.8747
AT1G26690			emp24/gp25L/p24 family/GOLD fa...		Potri.018G145544 [exp]	17.49	0.8692

Compare expression of checked genes

Potri.004G151800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.