Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-ACT2.2
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G18820 405 / 2e-146 RAB71, AtRABG3f, AtRab7B RAB GTPase homolog G3F (.1) AT1G49300 394 / 4e-142 ATRAB7, ATRABG3E ARABIDOPSIS RAB GTPASE HOMOLOG G3E, ARABIDOPSIS RAB GTPASE HOMOLOG 7, RAB GTPase homolog G3E (.1.2) AT3G16100 376 / 1e-134 AtRABG3c, AtRab7D RAB GTPase homolog G3C (.1) AT1G52280 375 / 2e-134 AtRABG3d RAB GTPase homolog G3D (.1) AT4G09720 315 / 2e-110 AtRABG3a RAB GTPase homolog G3A (.1.2.3.4) AT1G22740 312 / 1e-109 RAB75, RAB7, AtRABG3b RAB GTPase homolog G3B (.1) AT2G21880 279 / 3e-96 AtRab7A, AtRABG2 ARABIDOPSIS RAB GTPASE HOMOLOG G2, RAB GTPase homolog 7A (.1.2) AT5G39620 217 / 5e-72 AtRABG1 RAB GTPase homolog G1 (.1) AT1G28550 136 / 3e-40 AtRABA1i RAB GTPase homolog A1I (.1) AT2G33870 135 / 7e-40 ArRABA1h RAB GTPase homolog A1H (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G115000 [exp] 424 / 7e-154 AT3G18820 408 / 2e-147 RAB GTPase homolog G3F (.1) Potri.003G053400 [exp] 363 / 1e-129 AT1G52280 395 / 2e-142 RAB GTPase homolog G3D (.1) Potri.001G182900 [exp] 358 / 1e-127 AT3G16100 394 / 7e-142 RAB GTPase homolog G3C (.1) Potri.002G062400 [exp] 323 / 5e-114 AT4G09720 375 / 1e-134 RAB GTPase homolog G3A (.1.2.3.4) Potri.005G198800 [exp] 310 / 1e-108 AT4G09720 370 / 2e-132 RAB GTPase homolog G3A (.1.2.3.4) Potri.005G085300 [exp] 288 / 4e-100 AT4G09720 291 / 3e-101 RAB GTPase homolog G3A (.1.2.3.4) Potri.007G079700 [exp] 236 / 5e-80 AT4G09720 272 / 3e-94 RAB GTPase homolog G3A (.1.2.3.4) Potri.001G080400 [exp] 137 / 8e-41 AT1G02130 387 / 2e-139 ARABIDOPSIS THALIANA RAB D2A, ARABIDOPSIS THALIANA RESPONSIVE TO ABSCISIC ACID 1B, ARABIDOPSIS RAS 5, RAS 5 (.1) Potri.003G086700 [exp] 135 / 1e-39 AT2G44610 397 / 4e-143 Ras-related small GTP-binding family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040468 [exp] 415 / 4e-150 AT3G18820 403 / 2e-145 RAB GTPase homolog G3F (.1) Lus10035872 [exp] 383 / 2e-137 AT1G52280 397 / 4e-143 RAB GTPase homolog G3D (.1) Lus10042328 [exp] 382 / 4e-137 AT3G18820 367 / 3e-131 RAB GTPase homolog G3F (.1) Lus10023582 [exp] 339 / 2e-120 AT3G18820 330 / 4e-117 RAB GTPase homolog G3F (.1) Lus10028719 [exp] 295 / 8e-103 AT4G09720 341 / 5e-121 RAB GTPase homolog G3A (.1.2.3.4) Lus10006059 [exp] 281 / 2e-97 AT4G09720 323 / 4e-114 RAB GTPase homolog G3A (.1.2.3.4) Lus10025790 [exp] 242 / 4e-82 AT1G52280 257 / 5e-88 RAB GTPase homolog G3D (.1) Lus10005443 [exp] 133 / 9e-39 AT3G46060 394 / 2e-141 RAB GTPase homolog 8A (.1.2.3) Lus10043349 [exp] 132 / 2e-38 AT2G44610 407 / 5e-147 Ras-related small GTP-binding family protein (.1) Lus10019501 [exp] 132 / 2e-38 AT2G44610 407 / 5e-147 Ras-related small GTP-binding family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [poplar] [flax] P-loop_NTPase PF00025 [poplar] [flax] Arf ADP-ribosylation factor family
Representative CDS sequence Show only first row Show all	>Potri.004G153400.1 pacid=42795777 polypeptide=Potri.004G153400.1.p locus=Potri.004G153400 ID=Potri.004G153400.1.v4.1 annot-version=v4.1 ATGCCTTCCCGTAGAAGAACTCTCTTGAAGGTTATCATCCTCGGCGACAGCGGGGTAGGAAAGACCTCTTTGATGAATCAATATGTAAATAAGAAGTTTA GCAATCAATACAAGGCGACAATTGGAGCAGATTTTTTGACTAAGGAAGTTCAGTTTGAAGATAGGCTCTTCACTTTACAGATTTGGGATACTGCTGGGCA GGAAAGATTCCAAAGCCTTGGTGTTGCTTTCTATCGTGGTGCTGATTGTTGTGTCCTTGTATATGATGTCAACTCGATGAAATCTTTCGACCATCTTAAT AATTGGAGGGAAGAATTCCTCATTCAGGCAAGTCCTTCAGACCCAGAGAATTTCCCATTTGTTGTTCTTGGAAACAAGGTCGATGTGGATGGTGGAAATA GCAGAGTGGTTTCAGAGAAAAAGGCACGGGCATGGTGTGCTTCGAAAGGGAATATCCCTTACTTTGAGACCTCTGCCAAGGAAGGTGTTAATGTTGAGGA AGCTTTCCAATGCATAGCAAAGAATGCCCTGAAGAGTGGAGAAGAGGAAGAAATATACTTGCCAGACACCATTGATGTTGGAAGCAGCAGTCAGCCTAGG TCAACGGGATGCGAGTGCTAA
AA sequence Show only first row Show all	>Potri.004G153400.1 pacid=42795777 polypeptide=Potri.004G153400.1.p locus=Potri.004G153400 ID=Potri.004G153400.1.v4.1 annot-version=v4.1 MPSRRRTLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQIWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFDHLN NWREEFLIQASPSDPENFPFVVLGNKVDVDGGNSRVVSEKKARAWCASKGNIPYFETSAKEGVNVEEAFQCIAKNALKSGEEEEIYLPDTIDVGSSSQPR STGCEC

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G18820		RAB71, AtRABG3f...	RAB GTPase homolog G3F (.1)		Potri.004G153400 [exp]	0	1	Pt-ACT2.2
AT3G02520		GENERALREGULATO...	general regulatory factor 7 (....		Potri.004G101700 [exp]	1.00	0.7966
AT1G01910			P-loop containing nucleoside t...		Potri.014G078100 [exp]	1.41	0.7728
AT3G10640		VPS60.1	SNF7 family protein (.1.2)		Potri.008G018300 [exp]	2.44	0.7536
AT5G05987		PRA1.A2	prenylated RAB acceptor 1.A2 (...		Potri.010G198000 [exp]	2.82	0.7496
AT5G40650		SDH2-2	succinate dehydrogenase 2-2 (....		Potri.001G338400 [exp]	4.89	0.7600	SDH2.1
AT4G09830			Uncharacterised conserved prot...		Potri.002G064800 [exp]	5.19	0.7269
AT5G60860		AtRABA1f	RAB GTPase homolog A1F (.1)		Potri.001G374000 [exp]	10.24	0.7533	RAB11.4
AT4G39910		ATUBP3	ubiquitin-specific protease 3 ...		Potri.007G093600 [exp]	10.95	0.7139	Pt-UBP3.1
AT2G30050			transducin family protein / WD...		Potri.010G100400 [exp]	14.00	0.6929
AT2G30880			Pleckstrin homology (PH) domai...		Potri.005G205300 [exp]	19.20	0.6814

Compare expression of checked genes

Potri.004G153400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.