Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G39300 96 / 3e-27 unknown protein AT5G11630 43 / 2e-06 unknown protein AT4G17310 43 / 3e-06 unknown protein AT5G47455 39 / 6e-05 unknown protein AT1G55205 39 / 8e-05 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G115900 [exp] 157 / 2e-51 AT4G39300 114 / 1e-34 unknown protein Potri.006G237800 [exp] 47 / 4e-08 AT5G11630 99 / 8e-29 unknown protein Potri.017G068600 [exp] 41 / 1e-05 AT4G17310 94 / 2e-26 unknown protein Potri.001G333800 [exp] 39 / 0.0001 AT5G47455 54 / 1e-10 unknown protein Potri.002G045600 [exp] 37 / 0.0002 AT5G11630 69 / 5e-17 unknown protein
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026340 [exp] 103 / 2e-29 AT4G39300 100 / 5e-28 unknown protein Lus10023655 [exp] 42 / 9e-06 AT1G55205 83 / 3e-22 unknown protein Lus10032319 [exp] 42 / 1e-05 AT1G55205 75 / 5e-18 unknown protein Lus10024700 [exp] 42 / 1e-05 AT1G55205 80 / 4e-20 unknown protein Lus10028954 [exp] 40 / 2e-05 AT4G17310 100 / 5e-29 unknown protein Lus10011623 [exp] 39 / 7e-05 AT5G11630 82 / 2e-22 unknown protein Lus10007477 [exp] 39 / 7e-05 AT4G17310 95 / 6e-27 unknown protein Lus10026596 [exp] 37 / 0.0003 AT2G15000 123 / 6e-38 unknown protein Lus10002035 [exp] 37 / 0.0004 AT5G11630 80 / 3e-21 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.004G154800.3 pacid=42795091 polypeptide=Potri.004G154800.3.p locus=Potri.004G154800 ID=Potri.004G154800.3.v4.1 annot-version=v4.1 ATGGCGTCGTTTTGCAGATCGGCAATGACGGCAACCACAAGGTCCCTGGCATCTCTATCCAAAACGGCAGGTCAGAAAACACTATACGCGAAATCCATGT CTTCTCCGTTCACTTCAACACCAACACGAACTATCCTTGCCACTTCAAGGATTGTTTCAGTTTTAGGGAGCGTGGAGTCGTTGATGCCACTCCACAGTGC AATTGCAAATGCTAGACTCAAATCTAGCATCGCTGTTGATTCTTCTTGCTGGAGCTGGCTCTCTCAAGCTACCGAGTTTCTTCCATCTTTTCTTCCCTGG CATTTCCCAGATTTCGCAGTTCCTCGGTGA
AA sequence Show only first row Show all	>Potri.004G154800.3 pacid=42795091 polypeptide=Potri.004G154800.3.p locus=Potri.004G154800 ID=Potri.004G154800.3.v4.1 annot-version=v4.1 MASFCRSAMTATTRSLASLSKTAGQKTLYAKSMSSPFTSTPTRTILATSRIVSVLGSVESLMPLHSAIANARLKSSIAVDSSCWSWLSQATEFLPSFLPW HFPDFAVPR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G39300			unknown protein		Potri.004G154800 [exp]	0	1
AT4G20440		SMB	small nuclear ribonucleoprotei...		Potri.001G440100 [exp]	2.44	0.8468
AT5G11630			unknown protein		Potri.006G237800 [exp]	2.82	0.8528
AT5G45330		DCP5-L	decapping 5-like (.1)		Potri.004G235100 [exp]	5.19	0.7657
AT3G01280		VDAC1, ATVDAC1	ARABIDOPSIS THALIANA VOLTAGE D...		Potri.017G078200 [exp]	7.48	0.8160
AT2G42710			Ribosomal protein L1p/L10e fam...		Potri.014G143000 [exp]	7.54	0.8441
AT1G75330		OTC	ornithine carbamoyltransferase...		Potri.005G229400 [exp]	7.93	0.8191
AT1G16610		RNPS1, SR45	arginine/serine-rich 45 (.1.2....		Potri.011G143100 [exp]	9.38	0.7449	SR45.1
AT5G22100			RNA cyclase family protein (.1...		Potri.009G016000 [exp]	9.74	0.8259
AT5G56280		CSN6A	COP9 signalosome subunit 6A (....		Potri.011G169900 [exp]	12.48	0.7478	Pt-CSN6.1
AT2G47790			Transducin/WD40 repeat-like su...		Potri.014G130600 [exp]	14.00	0.7889

Compare expression of checked genes

Potri.004G154800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.