Potri.004G156100 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G21620 242 / 2e-82 RD2 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
AT3G62550 64 / 4e-13 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
AT5G14680 64 / 5e-13 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
AT3G58450 61 / 1e-11 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
AT1G68300 60 / 2e-11 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
AT3G01520 59 / 4e-11 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
AT3G11930 55 / 2e-09 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4)
AT3G17020 53 / 5e-09 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
AT3G53990 53 / 7e-09 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
AT3G03270 52 / 2e-08 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G156200 255 / 9e-88 AT2G21620 256 / 3e-88 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Potri.009G117500 249 / 3e-85 AT2G21620 258 / 5e-89 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Potri.017G071700 69 / 7e-15 AT5G14680 298 / 6e-105 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Potri.005G015200 68 / 2e-14 AT3G62550 156 / 4e-49 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Potri.010G123400 63 / 1e-12 AT1G68300 115 / 3e-33 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Potri.006G198200 63 / 3e-12 AT3G11930 209 / 9e-69 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4)
Potri.016G064000 62 / 4e-12 AT3G11930 214 / 4e-71 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4)
Potri.014G122000 62 / 4e-12 AT3G62550 195 / 1e-64 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Potri.006G092700 61 / 6e-12 AT3G53990 207 / 1e-69 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10042316 244 / 4e-83 AT2G21620 284 / 3e-99 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Lus10026346 241 / 2e-79 AT2G21620 269 / 5e-90 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Lus10042317 201 / 1e-65 AT2G21620 177 / 2e-56 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Lus10014545 63 / 1e-12 AT5G14680 295 / 6e-104 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Lus10032142 63 / 2e-12 AT5G14680 296 / 3e-104 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Lus10021501 58 / 4e-11 AT3G53990 144 / 3e-45 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Lus10041436 58 / 9e-11 AT1G68300 159 / 2e-50 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Lus10034337 57 / 3e-10 AT1G68300 164 / 2e-52 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Lus10021104 55 / 1e-09 AT3G53990 215 / 2e-72 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Lus10017207 55 / 2e-09 AT3G53990 217 / 2e-73 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0039 HUP PF00582 Usp Universal stress protein family
Representative CDS sequence
>Potri.004G156100.1 pacid=42794865 polypeptide=Potri.004G156100.1.p locus=Potri.004G156100 ID=Potri.004G156100.1.v4.1 annot-version=v4.1
ATGAATTCTAAAAATCTTGTAAGGAGAGAAAAACAGACGTTGAAAGCGTTAGAAACCCTTGAAGAGGATGAAGAGTACAACTGGAAAGAAGTTACGTTAC
CTTCATTTATTCCTGTGGTACCGAAACCTGAACTCGATAGAGAAACAGGTGAAAGGAGGAGAGGCAGAGACATTGTGGTAGCCATTGATCATGGGCCTAA
CAGCAAGCATGCATTTGATTGGGCCTTGATCCATCTTTGCCGCCTGGCTGACACCATTCATCTTGTTCATGCCATCCTAGATATGAAAAATGTCCTTGTT
TATGATACGACGGAGGGACTCCTGGAGAAGCTTGCAGTTGAGGCACTGCAGGTGGCAATGGTAAAAACTGTGGCTCGTATTGTACAAGGGGATCCAGGTA
AAGTAATCTGCCGAGAAGCAAACAGGTTAAAGCCAGCAGCTGTGGTCATGGGCACTAGAGGCAGAGGCTTAATCCAAAGTGTGCTGCAGGGTAGTGTGGG
GGAGTATTGCTTGCACAACTGTAAAGTGCCTGTCATAATTGTTCCTGGAAAAGCCGAGAGCGCACCGTTGATGTAG
AA sequence
>Potri.004G156100.1 pacid=42794865 polypeptide=Potri.004G156100.1.p locus=Potri.004G156100 ID=Potri.004G156100.1.v4.1 annot-version=v4.1
MNSKNLVRREKQTLKALETLEEDEEYNWKEVTLPSFIPVVPKPELDRETGERRRGRDIVVAIDHGPNSKHAFDWALIHLCRLADTIHLVHAILDMKNVLV
YDTTEGLLEKLAVEALQVAMVKTVARIVQGDPGKVICREANRLKPAAVVMGTRGRGLIQSVLQGSVGEYCLHNCKVPVIIVPGKAESAPLM

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G21620 RD2 Adenine nucleotide alpha hydro... Potri.004G156100 0 1
AT2G45400 BEN1 NAD(P)-binding Rossmann-fold s... Potri.002G147702 6.00 0.7152
AT3G51780 ATBAG4 BCL-2-associated athanogene 4 ... Potri.001G279500 11.22 0.7277
AT3G28450 Leucine-rich repeat protein ki... Potri.017G074400 18.49 0.7118
AT3G23200 Uncharacterised protein family... Potri.010G073000 21.42 0.6739
AT4G23895 Pleckstrin homology (PH) domai... Potri.001G091100 23.40 0.6996
AT2G25355 PNAS-3 related (.1.2) Potri.015G075400 32.83 0.6875
AT3G27200 Cupredoxin superfamily protein... Potri.001G332200 39.19 0.6854
AT1G53400 Ubiquitin domain-containing pr... Potri.011G107700 46.28 0.6580
AT3G57690 AGP23, ATAGP23 ARABINOGALACTAN-PROTEIN 23, ar... Potri.006G056200 55.74 0.6673
AT1G36980 unknown protein Potri.002G089300 58.58 0.6417

Potri.004G156100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.