Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G53560 47 / 2e-08 B5#2, ATB5-A, ATCB5-E ARABIDOPSIS CYTOCHROME B5 ISOFORM E, cytochrome B5 isoform E (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G024600 [exp] 92 / 4e-26 AT5G53560 163 / 5e-53 ARABIDOPSIS CYTOCHROME B5 ISOFORM E, cytochrome B5 isoform E (.1) Potri.013G029600 [exp] 89 / 2e-25 AT5G53560 43 / 1e-06 ARABIDOPSIS CYTOCHROME B5 ISOFORM E, cytochrome B5 isoform E (.1) Potri.014G167550 [exp] 79 / 4e-21 AT5G53560 66 / 1e-15 ARABIDOPSIS CYTOCHROME B5 ISOFORM E, cytochrome B5 isoform E (.1) Potri.011G070800 [exp] 77 / 6e-21 ND / Potri.011G055236 [exp] 77 / 2e-20 AT5G53560 0 / 1 ARABIDOPSIS CYTOCHROME B5 ISOFORM E, cytochrome B5 isoform E (.1) Potri.015G007600 [exp] 73 / 2e-18 AT5G53560 153 / 8e-49 ARABIDOPSIS CYTOCHROME B5 ISOFORM E, cytochrome B5 isoform E (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008838 [exp] 50 / 2e-09 AT5G53560 232 / 3e-80 ARABIDOPSIS CYTOCHROME B5 ISOFORM E, cytochrome B5 isoform E (.1) Lus10022357 [exp] 50 / 3e-09 AT5G53560 231 / 2e-79 ARABIDOPSIS CYTOCHROME B5 ISOFORM E, cytochrome B5 isoform E (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.004G157800.2 pacid=42796504 polypeptide=Potri.004G157800.2.p locus=Potri.004G157800 ID=Potri.004G157800.2.v4.1 annot-version=v4.1 ATGATGAAAAAGTATGTCATTGGTGAGGTAGATGTAACAACAGTTCCAACGAAACGCCTCTACGTAGCACCAGGTTTGGGAGGAACAAACCCTAAAGACG AGAAGCCTGGGTTTCTAATTAAGATCTTGCAGCTACTCGTGCCACTCCTGATCTTTGGCTTGGCTCTTGCTGTCCGAACCTACACCAAGAAAGAGTAG
AA sequence Show only first row Show all	>Potri.004G157800.2 pacid=42796504 polypeptide=Potri.004G157800.2.p locus=Potri.004G157800 ID=Potri.004G157800.2.v4.1 annot-version=v4.1 MMKKYVIGEVDVTTVPTKRLYVAPGLGGTNPKDEKPGFLIKILQLLVPLLIFGLALAVRTYTKKE

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G53560		B5#2, ATB5-A, A...	ARABIDOPSIS CYTOCHROME B5 ISOF...		Potri.004G157800 [exp]	0	1
					Potri.011G070800 [exp]	1.00	0.9674
AT5G60580			RING/U-box superfamily protein...		Potri.006G024000 [exp]	2.23	0.9284
AT1G16170			unknown protein		Potri.001G038750 [exp]	3.16	0.9399
AT5G18540			unknown protein		Potri.008G216700 [exp]	5.65	0.9187
AT4G39630			unknown protein		Potri.005G082500 [exp]	7.14	0.9063
AT1G53750		RPT1A	regulatory particle triple-A 1...		Potri.018G056600 [exp]	7.48	0.9129
AT4G39380			unknown protein		Potri.005G086800 [exp]	7.87	0.8961
AT1G64940		CYP89A6	"cytochrome P450, family 87, s...		Potri.013G076501 [exp]	10.09	0.8817
AT5G01700			Protein phosphatase 2C family ...		Potri.006G105000 [exp]	10.39	0.8800
AT1G65430		ATARI8, ARI8	ARABIDOPSIS ARIADNE 8, ARIADNE...		Potri.001G214201 [exp]	12.00	0.8986

Compare expression of checked genes

Potri.004G157800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.