Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G21490 56 / 3e-10 LEA dehydrin LEA (.1) AT4G39130 54 / 1e-09 Dehydrin family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G120100 [exp] 134 / 5e-41 AT4G39130 52 / 1e-08 Dehydrin family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017977 [exp] 59 / 3e-11 AT5G66400 66 / 2e-13 RESPONSIVE TO ABA 18, ARABIDOPSIS THALIANA DROUGHT-INDUCED 8, Dehydrin family protein (.1.2) Lus10041969 [exp] 56 / 5e-10 AT5G66400 66 / 2e-13 RESPONSIVE TO ABA 18, ARABIDOPSIS THALIANA DROUGHT-INDUCED 8, Dehydrin family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00257 [poplar] [flax] Dehydrin Dehydrin
Representative CDS sequence Show only first row Show all	>Potri.004G158500.1 pacid=42796375 polypeptide=Potri.004G158500.1.p locus=Potri.004G158500 ID=Potri.004G158500.1.v4.1 annot-version=v4.1 ATGGCTGCCACAATAAGAGATGAGCAAGGCAATCCAATTCAACTCACAGATGAATATGGCAACCCGGTTCAGTTAACAGATGAACATGGTAACCCTGTAC AGATCACTGGCATAGCCACCACCAAACAACCTCCGACGCTTGGCAATGTAAGTAGTGATCAGGTACCTGGTACTGGACTTTTGTCTAGTACTGCCATGAG CGAAGATGCAACGAAGGGCACTGACATTCTTGAGACGGGACAGCATGGTGGGTTTGCTGCTGACCAAGGTGGACATAAGAAAGAGGAGCAGGAAGAGATT TCATCTACTTCAAGCTCTGGCACGTCTGAGGACGATGGGCGAGGAGGGAGAAAAGGGCTGAAGGAGAAAATAAAGGAGAAATTAACTTGCGGGAAGCACT AG
AA sequence Show only first row Show all	>Potri.004G158500.1 pacid=42796375 polypeptide=Potri.004G158500.1.p locus=Potri.004G158500 ID=Potri.004G158500.1.v4.1 annot-version=v4.1 MAATIRDEQGNPIQLTDEYGNPVQLTDEHGNPVQITGIATTKQPPTLGNVSSDQVPGTGLLSSTAMSEDATKGTDILETGQHGGFAADQGGHKKEEQEEI SSTSSSGTSEDDGRGGRKGLKEKIKEKLTCGKH

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G21490		LEA	dehydrin LEA (.1)		Potri.004G158500 [exp]	0	1
AT4G31830			unknown protein		Potri.006G183800 [exp]	1.00	0.9281
AT3G18950			Transducin/WD40 repeat-like su...		Potri.009G109500 [exp]	1.41	0.9267
AT5G52300		LTI65, RD29B	RESPONSIVE TO DESSICATION 29B,...		Potri.012G141300 [exp]	2.44	0.9212
AT5G67265			unknown protein		Potri.002G122800 [exp]	3.74	0.8862
AT5G51760		AHG1	ABA-hypersensitive germination...		Potri.015G133900 [exp]	4.00	0.9167
AT3G30380			alpha/beta-Hydrolases superfam...		Potri.017G102500 [exp]	4.47	0.9103
AT2G18540			RmlC-like cupins superfamily p...		Potri.007G029100 [exp]	6.00	0.8876
AT2G36640		ATECP63	embryonic cell protein 63 (.1)		Potri.015G060600 [exp]	6.32	0.8836	ATECP63.1
AT4G33150		LKR/SDH, SDH	lysine-ketoglutarate reductase...		Potri.006G134450 [exp]	9.79	0.8435
AT4G37850	bHLH	bHLH025	basic helix-loop-helix (bHLH) ...		Potri.009G081400 [exp]	12.40	0.8460

Compare expression of checked genes

Potri.004G158500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.