Potri.004G160200 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G16430 72 / 9e-16 ATPAP10, PAP10 purple acid phosphatase 10 (.1.2)
AT4G36350 71 / 1e-15 ATPAP25, PAP25 ARABIDOPSIS THALIANA PURPLE ACID PHOSPHATASE 25, purple acid phosphatase 25 (.1)
AT1G56360 71 / 2e-15 PAP6, ATPAP6 purple acid phosphatase 6 (.1)
AT2G27190 70 / 5e-15 ATPAP12 ARABIDOPSIS THALIANA PURPLE ACID PHOSPHATASE 1, purple acid phosphatase 12 (.1)
AT3G46120 69 / 8e-15 ATPAP19, PAP19 purple acid phosphatase 19 (.1)
AT2G18130 66 / 9e-14 PAP11, ATPAP11 purple acid phosphatase 11 (.1)
AT1G52940 66 / 1e-13 PAP5, ATPAP5 purple acid phosphatase 5 (.1)
AT5G34850 58 / 7e-11 ATPAP26, PAP26 purple acid phosphatase 26 (.1)
AT3G20500 44 / 8e-06 ATPAP18, PAP18 purple acid phosphatase 18 (.1)
AT3G52780 44 / 8e-06 ATPAP20, PAP20 Purple acid phosphatases superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G121200 80 / 2e-18 AT2G16430 773 / 0.0 purple acid phosphatase 10 (.1.2)
Potri.004G160100 78 / 8e-18 AT2G16430 779 / 0.0 purple acid phosphatase 10 (.1.2)
Potri.002G029300 73 / 3e-16 AT2G16430 693 / 0.0 purple acid phosphatase 10 (.1.2)
Potri.005G233400 71 / 2e-15 AT2G16430 700 / 0.0 purple acid phosphatase 10 (.1.2)
Potri.018G024800 63 / 9e-13 AT5G34850 742 / 0.0 purple acid phosphatase 26 (.1)
Potri.018G123700 59 / 3e-11 AT5G34850 762 / 0.0 purple acid phosphatase 26 (.1)
Potri.006G063700 56 / 5e-10 AT5G34850 798 / 0.0 purple acid phosphatase 26 (.1)
Potri.001G423700 50 / 5e-08 AT3G20500 701 / 0.0 purple acid phosphatase 18 (.1)
Potri.011G138200 46 / 1e-06 AT3G20500 696 / 0.0 purple acid phosphatase 18 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017484 77 / 1e-17 AT2G16430 748 / 0.0 purple acid phosphatase 10 (.1.2)
Lus10028799 76 / 4e-17 AT2G16430 746 / 0.0 purple acid phosphatase 10 (.1.2)
Lus10041959 75 / 1e-16 AT2G16430 731 / 0.0 purple acid phosphatase 10 (.1.2)
Lus10017485 75 / 1e-16 AT2G16430 671 / 0.0 purple acid phosphatase 10 (.1.2)
Lus10006126 74 / 2e-16 AT2G27190 681 / 0.0 ARABIDOPSIS THALIANA PURPLE ACID PHOSPHATASE 1, purple acid phosphatase 12 (.1)
Lus10028798 74 / 2e-16 AT2G16430 673 / 0.0 purple acid phosphatase 10 (.1.2)
Lus10024299 70 / 6e-15 AT2G27190 612 / 0.0 ARABIDOPSIS THALIANA PURPLE ACID PHOSPHATASE 1, purple acid phosphatase 12 (.1)
Lus10008054 59 / 5e-11 AT5G34850 774 / 0.0 purple acid phosphatase 26 (.1)
Lus10039978 54 / 2e-09 AT5G34850 784 / 0.0 purple acid phosphatase 26 (.1)
Lus10027710 52 / 1e-08 AT5G34850 790 / 0.0 purple acid phosphatase 26 (.1)
PFAM info
Representative CDS sequence
>Potri.004G160200.1 pacid=42796762 polypeptide=Potri.004G160200.1.p locus=Potri.004G160200 ID=Potri.004G160200.1.v4.1 annot-version=v4.1
ATGGCTGAATGTTGTTTTGCTCGTAGCATTCTGTGGAAGGTAATATGCTCTCGCTACGCGGAAGGGGAGTCCATGGCAGTAGCTTGGAGCCTGTTTTTGT
TCGACATTGCATACAACATTACAAACGGAGATTGCTCTGTAAAAAAAGAATCAATCGGCTCCTGTGTTACACCGCCATTGTCCATTAGTGATGGAGGGCA
TCTCGGAGGCCTGGTAAACAACTTGGCACGTCCACGGCCATATCACTCAGCAAATCGTGAGGCCAGTTTTGGTCATGCCGTTTTCGATACGAGGAACAGA
ACTCATGTTTACTATACCCGGGATTGCAATGAAGATGTTGGAAACTTGTTTTAA
AA sequence
>Potri.004G160200.1 pacid=42796762 polypeptide=Potri.004G160200.1.p locus=Potri.004G160200 ID=Potri.004G160200.1.v4.1 annot-version=v4.1
MAECCFARSILWKVICSRYAEGESMAVAWSLFLFDIAYNITNGDCSVKKESIGSCVTPPLSISDGGHLGGLVNNLARPRPYHSANREASFGHAVFDTRNR
THVYYTRDCNEDVGNLF

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G16430 ATPAP10, PAP10 purple acid phosphatase 10 (.1... Potri.004G160200 0 1
AT5G28780 PIF1 helicase (.1) Potri.006G157501 10.39 1.0000
AT1G02790 PGA4 polygalacturonase 4 (.1) Potri.010G011200 10.77 1.0000
AT3G02310 MADS AGL4, SEP2 SEPALLATA 2, AGAMOUS-like 4, K... Potri.004G115500 15.42 1.0000
AT2G24370 Protein kinase protein with ad... Potri.018G002400 21.23 1.0000
Potri.006G055550 28.56 0.9414
AT5G60440 MADS AGL62 AGAMOUS-like 62 (.1) Potri.009G084200 32.55 0.9368
Potri.001G380550 33.09 0.9251
Potri.010G080666 37.30 0.9904
Potri.001G169351 38.17 1.0000
Potri.001G196900 38.57 1.0000

Potri.004G160200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.