Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G38960 248 / 1e-84 CO B-box type zinc finger family protein (.1.2.3) AT2G21320 216 / 4e-72 CO B-box zinc finger family protein (.1) AT1G78600 105 / 3e-27 CO BBX22, DBB3, STH3, LZF1 SALT TOLERANCE HOMOLOG 3, DOUBLE B-BOX 3, B-box domain protein 22, light-regulated zinc finger protein 1 (.1.2) AT1G06040 100 / 5e-26 CO BBX24, STO SALT TOLERANCE, B-box domain protein 24, B-box zinc finger family protein (.1.2) AT4G39070 94 / 2e-23 CO B-box zinc finger family protein (.1) AT1G75540 95 / 3e-23 CO LHUS, AtBBX21, STH2 long hypocotyl under shade, B-box domain protein 21, B BOX 21, salt tolerance homolog2 (.1) AT2G31380 90 / 4e-22 CO STH salt tolerance homologue (.1) AT2G24790 88 / 7e-21 CO COL3, ATCOL3 CONSTANS-like 3 (.1.2) AT5G24930 87 / 3e-20 CO COL4, ATCOL4 CONSTANS-like 4 (.1) AT5G15850 86 / 6e-20 CO COL1, ATCOL1 CONSTANS-like 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G124400 [exp] 382 / 2e-137 AT4G38960 251 / 8e-86 B-box type zinc finger family protein (.1.2.3) Potri.007G015200 [exp] 272 / 4e-94 AT4G38960 197 / 5e-65 B-box type zinc finger family protein (.1.2.3) Potri.005G117100 [exp] 262 / 5e-90 AT2G21320 192 / 4e-63 B-box zinc finger family protein (.1) Potri.001G384000 [exp] 106 / 8e-28 AT1G78600 284 / 1e-95 SALT TOLERANCE HOMOLOG 3, DOUBLE B-BOX 3, B-box domain protein 22, light-regulated zinc finger protein 1 (.1.2) Potri.004G161000 [exp] 100 / 5e-26 AT4G39070 192 / 6e-62 B-box zinc finger family protein (.1) Potri.011G105400 [exp] 101 / 9e-26 AT1G78600 284 / 1e-95 SALT TOLERANCE HOMOLOG 3, DOUBLE B-BOX 3, B-box domain protein 22, light-regulated zinc finger protein 1 (.1.2) Potri.002G028200 [exp] 99 / 6e-25 AT1G75540 252 / 2e-82 long hypocotyl under shade, B-box domain protein 21, B BOX 21, salt tolerance homolog2 (.1) Potri.005G234500 [exp] 97 / 3e-24 AT1G75540 185 / 2e-56 long hypocotyl under shade, B-box domain protein 21, B BOX 21, salt tolerance homolog2 (.1) Potri.009G122000 [exp] 93 / 3e-23 AT4G39070 202 / 1e-65 B-box zinc finger family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031087 [exp] 281 / 4e-97 AT4G38960 229 / 5e-77 B-box type zinc finger family protein (.1.2.3) Lus10035472 [exp] 274 / 2e-94 AT4G38960 229 / 4e-77 B-box type zinc finger family protein (.1.2.3) Lus10018076 [exp] 224 / 6e-75 AT4G38960 215 / 6e-72 B-box type zinc finger family protein (.1.2.3) Lus10042069 [exp] 113 / 6e-32 AT4G38960 112 / 5e-32 B-box type zinc finger family protein (.1.2.3) Lus10028791 [exp] 100 / 4e-26 AT1G75540 206 / 9e-66 long hypocotyl under shade, B-box domain protein 21, B BOX 21, salt tolerance homolog2 (.1) Lus10038147 [exp] 100 / 2e-25 AT1G78600 281 / 2e-94 SALT TOLERANCE HOMOLOG 3, DOUBLE B-BOX 3, B-box domain protein 22, light-regulated zinc finger protein 1 (.1.2) Lus10042498 [exp] 100 / 2e-25 AT1G78600 274 / 1e-91 SALT TOLERANCE HOMOLOG 3, DOUBLE B-BOX 3, B-box domain protein 22, light-regulated zinc finger protein 1 (.1.2) Lus10017495 [exp] 99 / 2e-25 AT1G75540 202 / 2e-64 long hypocotyl under shade, B-box domain protein 21, B BOX 21, salt tolerance homolog2 (.1) Lus10025579 [exp] 89 / 2e-21 AT1G06040 297 / 2e-102 SALT TOLERANCE, B-box domain protein 24, B-box zinc finger family protein (.1.2) Lus10027041 [exp] 88 / 4e-21 AT1G06040 298 / 1e-102 SALT TOLERANCE, B-box domain protein 24, B-box zinc finger family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00643 [poplar] [flax] zf-B_box B-box zinc finger
Representative CDS sequence Show only first row Show all	>Potri.004G162600.6 pacid=42795584 polypeptide=Potri.004G162600.6.p locus=Potri.004G162600 ID=Potri.004G162600.6.v4.1 annot-version=v4.1 ATGCGAATGCTTTGTGATGTGTGTGAAAGCGCAGCTGCGATTCTTTTCTGTGCTGCTGATGAAGCCGCGCTTTGCCGCTCCTGCGACGAGAAGGTTCATA TGTGTAACAAGCTAGCTAGTCGGCATGTACGAGTAGGACTTGCAGATCCTAGTGATGTTCCACAGTGTGACATATGTGAAAAGGCACCAGCTTTCTTTTA CTGCGAGATAGATGGCAGTTCGCTCTGCTTGCAATGTGATATGATAGTGCATGTTGGTGGTAAAAGGACCCATGGGAGATATCTCCTGTTGAGGCAGAGA GTTGAGTTTCCAGGGGATAAACCTGGCTGTACAGAGGAACAAGGACAGCAACCGCTTGATGATAATGAAACAAGAAGGGACCAAAATCAGCCGCCTAAGC TCACAGCTAGAGAAAATCAACAGAACCACAGGGCCTCTCCAGTTCCAATGGTAGAGAATAACACTGATAGTGACGGGAAAATGGACAACAAATTGATTGA TCTTAATGCCAGGCCTCAGCGTGTACATGGGAAAAATCCAACTAACCAGGAAAACCATGAATCCTCTAGTTTGGCTCCTTTTGGATTCTTTAAAGGGGAG CCACAAAAGTAA
AA sequence Show only first row Show all	>Potri.004G162600.6 pacid=42795584 polypeptide=Potri.004G162600.6.p locus=Potri.004G162600 ID=Potri.004G162600.6.v4.1 annot-version=v4.1 MRMLCDVCESAAAILFCAADEAALCRSCDEKVHMCNKLASRHVRVGLADPSDVPQCDICEKAPAFFYCEIDGSSLCLQCDMIVHVGGKRTHGRYLLLRQR VEFPGDKPGCTEEQGQQPLDDNETRRDQNQPPKLTARENQQNHRASPVPMVENNTDSDGKMDNKLIDLNARPQRVHGKNPTNQENHESSSLAPFGFFKGE PQK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G38960	CO		B-box type zinc finger family ...		Potri.004G162600 [exp]	0	1
AT1G05690		BT3	BTB and TAZ domain protein 3 (...		Potri.007G140400 [exp]	1.00	0.8091
AT3G63120		CYCP1;1	cyclin p1;1 (.1)		Potri.005G209800 [exp]	4.47	0.8010
AT2G25910			3'-5' exonuclease domain-conta...		Potri.018G058900 [exp]	5.29	0.7677
AT4G29100	bHLH	bHLH068	basic helix-loop-helix (bHLH) ...		Potri.018G083700 [exp]	6.92	0.7710
AT1G23890			NHL domain-containing protein ...		Potri.004G087300 [exp]	9.00	0.7087
AT4G16400			unknown protein		Potri.006G017900 [exp]	12.24	0.7601
AT5G43150			unknown protein		Potri.003G187500 [exp]	12.64	0.7663
AT2G01910		ATMAP65-6	Microtubule associated protein...		Potri.008G139700 [exp]	14.28	0.7830
AT3G05675			BTB/POZ domain-containing prot...		Potri.006G202900 [exp]	15.68	0.6819
					Potri.015G054350 [exp]	17.49	0.7325

Compare expression of checked genes

Potri.004G162600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.