Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G34700 174 / 1e-57 CIB22, AtCIB22 B22 subunit of eukaryotic mitochondrial Complex I, LYR family of Fe/S cluster biogenesis protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G124600 [exp] 209 / 1e-71 AT4G34700 171 / 9e-57 B22 subunit of eukaryotic mitochondrial Complex I, LYR family of Fe/S cluster biogenesis protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042049 [exp] 184 / 2e-61 AT4G34700 195 / 4e-66 B22 subunit of eukaryotic mitochondrial Complex I, LYR family of Fe/S cluster biogenesis protein (.1) Lus10031084 [exp] 173 / 2e-57 AT4G34700 176 / 1e-58 B22 subunit of eukaryotic mitochondrial Complex I, LYR family of Fe/S cluster biogenesis protein (.1) Lus10035469 [exp] 175 / 5e-57 AT4G34700 176 / 2e-57 B22 subunit of eukaryotic mitochondrial Complex I, LYR family of Fe/S cluster biogenesis protein (.1) Lus10018052 [exp] 167 / 1e-53 AT4G34700 179 / 5e-58 B22 subunit of eukaryotic mitochondrial Complex I, LYR family of Fe/S cluster biogenesis protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0491 [poplar] [flax] LYR-like PF05347 [poplar] [flax] Complex1_LYR Complex 1 protein (LYR family)
Representative CDS sequence Show only first row Show all	>Potri.004G163000.2 pacid=42794559 polypeptide=Potri.004G162916.1.p locus=Potri.004G163000 ID=Potri.004G163000.2.v4.1 annot-version=v4.1 ATGAGCGTCGCAGCAGCAGCAGCAGCGGGCTACCTGGGTCGAAGAGCAGCACAGAAGGAGAGAGTGAGAATCCTCTACCGCCGTGCTCTCAAAGACACTC TTAACTGGGCAGTCCATCGCCACCTCTTTTACGAAGACGCCGATCTTCTGCGCGCGAGGTTCGAAACAAGCAAACACGTGGAAGATCCGGATACAATTGA TAGAATGATAGCTGATGGCGAGGCGCAGTACAATAAGTGGCGGCACCCTGATCCTTATATTGTACCTTGGGCTCCTGGCGGCAGCAAGTTCACTCGGAAC CCGACTCCACCTGAAGGGATTGAGATAGTGTATAACTATGGCCGAGAAGATAATGACTAG
AA sequence Show only first row Show all	>Potri.004G163000.2 pacid=42794559 polypeptide=Potri.004G162916.1.p locus=Potri.004G163000 ID=Potri.004G163000.2.v4.1 annot-version=v4.1 MSVAAAAAAGYLGRRAAQKERVRILYRRALKDTLNWAVHRHLFYEDADLLRARFETSKHVEDPDTIDRMIADGEAQYNKWRHPDPYIVPWAPGGSKFTRN PTPPEGIEIVYNYGREDND

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G34700		CIB22, AtCIB22	B22 subunit of eukaryotic mito...		Potri.004G163000 [exp]	0	1
AT4G28980		CAK1AT, CDKF;1	CYCLIN-DEPENDENT KINASE F;1, C...		Potri.018G083300 [exp]	3.16	0.9089	Pt-CAK1.2
AT5G09900		RPN5A, MSA, EMB...	REGULATORY PARTICLE NON-ATPASE...		Potri.007G076900 [exp]	4.47	0.9193
AT5G59410			Rab5-interacting family protei...		Potri.009G032100 [exp]	6.24	0.9270
AT3G55440		CYTOTPI, ATCTIM...	CYTOSOLIC ISOFORM TRIOSE PHOSP...		Potri.009G031200 [exp]	7.74	0.9304
AT1G79500		ATKDSA1, KDSA	Aldolase-type TIM barrel famil...		Potri.005G199100 [exp]	8.94	0.9170	Pt-KDSA.2
AT5G51960			unknown protein		Potri.008G044200 [exp]	10.48	0.9073
AT5G52840			NADH-ubiquinone oxidoreductase...		Potri.004G071900 [exp]	13.41	0.9137
AT4G02580			NADH-ubiquinone oxidoreductase...		Potri.005G218000 [exp]	15.49	0.9101
AT4G00585			unknown protein		Potri.002G155800 [exp]	16.15	0.9099
AT1G53750		RPT1A	regulatory particle triple-A 1...		Potri.018G056600 [exp]	18.00	0.8977

Compare expression of checked genes

Potri.004G163000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.