Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G01130 54 / 4e-12 unknown protein AT5G15320 49 / 7e-10 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G125832 [exp] 63 / 2e-15 AT3G01130 55 / 2e-12 unknown protein Potri.002G024900 [exp] 57 / 4e-13 AT5G15320 76 / 1e-20 unknown protein Potri.005G236500 [exp] 51 / 7e-11 AT5G15320 36 / 9e-05 unknown protein
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033166 [exp] 59 / 4e-12 AT5G39600 207 / 1e-67 unknown protein Lus10018064 [exp] 42 / 2e-07 AT5G15320 71 / 9e-19 unknown protein Lus10042059 [exp] 42 / 1e-06 AT3G01130 58 / 2e-12 unknown protein
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05680 [poplar] [flax] ATP-synt_E ATP synthase E chain
Representative CDS sequence Show only first row Show all	>Potri.004G164066.1 pacid=42794326 polypeptide=Potri.004G164066.1.p locus=Potri.004G164066 ID=Potri.004G164066.1.v4.1 annot-version=v4.1 ATGGCGCCGCCTCCTGGACCTTACTCTGGTACCAGCACTCTCGCTTTGGTGGCTCGTGTTTCTGCTTTCTCTTTGGGTCTCGTCTACGGGAGTGTGAAGC TAAAGTATCTCCAGGCAAAGGCAAAGTCACAAAAGAAAGCTGAAGCAAAGGCTCATCATTAA
AA sequence Show only first row Show all	>Potri.004G164066.1 pacid=42794326 polypeptide=Potri.004G164066.1.p locus=Potri.004G164066 ID=Potri.004G164066.1.v4.1 annot-version=v4.1 MAPPPGPYSGTSTLALVARVSAFSLGLVYGSVKLKYLQAKAKSQKKAEAKAHH

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G01130			unknown protein		Potri.004G164066 [exp]	0	1
AT1G22520			Domain of unknown function (DU...		Potri.013G105766 [exp]	8.00	0.7544
AT1G51980			Insulinase (Peptidase family M...		Potri.001G191100 [exp]	9.48	0.7818
AT2G24765		ARF3, ARL1, ATA...	ARF-LIKE 1, ADP-ribosylation f...		Potri.006G267800 [exp]	17.83	0.6814	ARF1.8
AT3G25020		AtRLP42	receptor like protein 42 (.1)		Potri.011G162101 [exp]	23.28	0.6186
AT1G04630		MEE4	maternal effect embryo arrest ...		Potri.001G054500 [exp]	26.45	0.7191
AT4G28950		ATRAC7, ARAC7, ...	Arabidopsis RAC-like 7, RHO-re...		Potri.018G083400 [exp]	29.25	0.7532	Pt-ARAC7.2
AT3G03420			Ku70-binding family protein (....		Potri.017G120800 [exp]	35.32	0.6614
AT5G43330		c-NAD-MDH2	cytosolic-NAD-dependent malate...		Potri.008G166800 [exp]	45.00	0.7164	CMDH.2
AT3G10860			Cytochrome b-c1 complex, subun...		Potri.013G159700 [exp]	49.14	0.6726
AT3G52630			Nucleic acid-binding, OB-fold-...		Potri.006G211900 [exp]	51.76	0.7084

Compare expression of checked genes

Potri.004G164066 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.