Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G34770 149 / 2e-48 SAUR-like auxin-responsive protein family (.1) AT4G34800 100 / 3e-29 SAUR-like auxin-responsive protein family (.1) AT4G38840 99 / 2e-28 SAUR-like auxin-responsive protein family (.1) AT2G21210 98 / 4e-28 SAUR-like auxin-responsive protein family (.1) AT5G18020 98 / 5e-28 SAUR-like auxin-responsive protein family (.1) AT5G18060 96 / 3e-27 SAUR-like auxin-responsive protein family (.1) AT5G18050 95 / 5e-27 SAUR-like auxin-responsive protein family (.1) AT5G18080 95 / 6e-27 SAUR24 small auxin up RNA 24, SAUR-like auxin-responsive protein family (.1) AT4G34810 95 / 1e-26 SAUR-like auxin-responsive protein family (.1) AT5G18030 94 / 1e-26 SAUR-like auxin-responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G165600 [exp] 117 / 9e-36 AT4G34770 118 / 4e-36 SAUR-like auxin-responsive protein family (.1) Potri.009G126700 [exp] 108 / 2e-32 AT4G38840 126 / 3e-39 SAUR-like auxin-responsive protein family (.1) Potri.009G126500 [exp] 107 / 5e-32 AT5G18020 124 / 1e-38 SAUR-like auxin-responsive protein family (.1) Potri.004G165500 [exp] 105 / 7e-31 AT4G34770 115 / 7e-35 SAUR-like auxin-responsive protein family (.1) Potri.004G165400 [exp] 104 / 1e-30 AT5G18080 110 / 3e-33 small auxin up RNA 24, SAUR-like auxin-responsive protein family (.1) Potri.009G127100 [exp] 102 / 5e-30 AT5G18080 103 / 2e-30 small auxin up RNA 24, SAUR-like auxin-responsive protein family (.1) Potri.009G126300 [exp] 100 / 7e-29 AT5G18060 123 / 2e-38 SAUR-like auxin-responsive protein family (.1) Potri.004G165200 [exp] 100 / 8e-29 AT5G18020 122 / 6e-38 SAUR-like auxin-responsive protein family (.1) Potri.004G164700 [exp] 99 / 1e-28 AT5G18020 122 / 8e-38 SAUR-like auxin-responsive protein family (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042376 [exp] 135 / 7e-43 AT4G34770 136 / 3e-43 SAUR-like auxin-responsive protein family (.1) Lus10012185 [exp] 129 / 1e-40 AT4G34770 139 / 3e-44 SAUR-like auxin-responsive protein family (.1) Lus10007560 [exp] 127 / 1e-39 AT4G34770 139 / 3e-44 SAUR-like auxin-responsive protein family (.1) Lus10025911 [exp] 100 / 6e-29 AT4G38840 118 / 4e-36 SAUR-like auxin-responsive protein family (.1) Lus10009620 [exp] 99 / 2e-28 AT4G38840 112 / 5e-34 SAUR-like auxin-responsive protein family (.1) Lus10025909 [exp] 99 / 3e-28 AT4G34770 116 / 3e-35 SAUR-like auxin-responsive protein family (.1) Lus10039020 [exp] 98 / 4e-28 AT5G18020 118 / 2e-36 SAUR-like auxin-responsive protein family (.1) Lus10008996 [exp] 97 / 1e-27 AT4G38840 116 / 2e-35 SAUR-like auxin-responsive protein family (.1) Lus10038193 [exp] 97 / 1e-27 AT4G38840 121 / 3e-37 SAUR-like auxin-responsive protein family (.1) Lus10027317 [exp] 97 / 1e-27 AT5G18030 119 / 1e-36 SAUR-like auxin-responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02519 [poplar] [flax] Auxin_inducible Auxin responsive protein
Representative CDS sequence Show only first row Show all	>Potri.004G165800.1 pacid=42795695 polypeptide=Potri.004G165800.1.p locus=Potri.004G165800 ID=Potri.004G165800.1.v4.1 annot-version=v4.1 ATGGGAATTCAATTGATGGGGATTACTCATGCCAAACAAAAACTCCAAAGAAGTCTTTCAGCAAAAATCGCTGGGGTTTTGGCCACTTCTAATGTTCCAA GAGGCCACATTGCTGTCTATGTTGGAGAAGGCTACAGAAAGAGATGTGTTATTCCAATAGCATACTTGAACCATCCTTTATTCCAAGGCTTGCTAAATCG AGCTGAGGAGGAATTTGGATTCGATCATCCAATGGGTGGTCTCACAATACCTTGCAGTGAAGAGTGCTTCGTTAGCCTCACTTCGTTTCTAAGTAGCACT TCATAA
AA sequence Show only first row Show all	>Potri.004G165800.1 pacid=42795695 polypeptide=Potri.004G165800.1.p locus=Potri.004G165800 ID=Potri.004G165800.1.v4.1 annot-version=v4.1 MGIQLMGITHAKQKLQRSLSAKIAGVLATSNVPRGHIAVYVGEGYRKRCVIPIAYLNHPLFQGLLNRAEEEFGFDHPMGGLTIPCSEECFVSLTSFLSST S

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G34770			SAUR-like auxin-responsive pro...		Potri.004G165800 [exp]	0	1
AT1G07710			Ankyrin repeat family protein ...		Potri.005G069400 [exp]	3.60	0.7766
AT5G44680			DNA glycosylase superfamily pr...		Potri.008G081000 [exp]	4.47	0.7636
AT3G42640		AHA8	H\(+\)-ATPase 8, H\(+\)-ATPase...		Potri.006G005900 [exp]	5.00	0.7410	Pt-AHA6.2
AT3G63430			unknown protein		Potri.005G216300 [exp]	6.00	0.7469
AT5G24580			Heavy metal transport/detoxifi...		Potri.015G003900 [exp]	7.54	0.7496
AT2G39980			HXXXD-type acyl-transferase fa...		Potri.010G192400 [exp]	9.48	0.6821
AT5G20820			SAUR-like auxin-responsive pro...		Potri.006G137000 [exp]	12.48	0.6866	SAUR6
AT1G72490			unknown protein		Potri.001G166700 [exp]	12.64	0.7027
AT2G40610		ATHEXPALPHA1.11...	expansin A8 (.1)		Potri.013G154700 [exp]	12.96	0.6898	Pt-EXP2.8,PtrEXPA2
AT1G79420			Protein of unknown function (D...		Potri.008G081700 [exp]	13.78	0.6733

Compare expression of checked genes

Potri.004G165800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.