Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	VCCYP.1
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G16600 278 / 4e-97 ROC3 rotamase CYP 3 (.1.2) AT2G21130 276 / 3e-96 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT4G38740 275 / 7e-96 ROC1 rotamase CYP 1 (.1) AT4G34870 266 / 1e-92 ATCYP1, ROC5 ARABIDOPSIS THALIANA CYCLOPHILIN 1, rotamase cyclophilin 5 (.1) AT3G56070 245 / 4e-84 ROC2 rotamase cyclophilin 2 (.1.2) AT2G29960 223 / 3e-75 CYP19-4, ATCYP5, CYP5 CYCLOPHILIN 19-4, ARABIDOPSIS THALIANA CYCLOPHILIN 5, cyclophilin 5 (.1.2) AT5G58710 216 / 2e-72 ROC7 rotamase CYP 7 (.1) AT3G63400 218 / 2e-70 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1.2.3) AT3G55920 208 / 8e-69 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT5G13120 199 / 1e-64 Pnsl5, ATCYP20-2 Photosynthetic NDH subcomplex L 5, ARABIDOPSIS THALIANA CYCLOPHILIN 20-2, cyclophilin 20-2 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G130100 [exp] 307 / 1e-108 AT2G21130 279 / 1e-97 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.002G021500 [exp] 295 / 5e-104 AT2G16600 278 / 2e-97 rotamase CYP 3 (.1.2) Potri.005G240200 [exp] 287 / 1e-100 AT2G16600 276 / 2e-96 rotamase CYP 3 (.1.2) Potri.019G014396 [exp] 254 / 1e-87 AT3G56070 277 / 1e-96 rotamase cyclophilin 2 (.1.2) Potri.009G046500 [exp] 221 / 3e-74 AT2G29960 323 / 4e-114 CYCLOPHILIN 19-4, ARABIDOPSIS THALIANA CYCLOPHILIN 5, cyclophilin 5 (.1.2) Potri.010G189000 [exp] 221 / 1e-73 AT3G55920 303 / 4e-105 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.001G251700 [exp] 215 / 8e-72 AT5G58710 313 / 6e-110 rotamase CYP 7 (.1) Potri.005G215800 [exp] 223 / 9e-70 AT3G63400 252 / 2e-77 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1.2.3) Potri.002G047200 [exp] 212 / 2e-65 AT3G63400 229 / 1e-66 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1.2.3)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012167 [exp] 298 / 5e-105 AT2G16600 313 / 4e-111 rotamase CYP 3 (.1.2) Lus10007579 [exp] 296 / 2e-104 AT2G16600 311 / 2e-110 rotamase CYP 3 (.1.2) Lus10017258 [exp] 272 / 1e-94 AT2G16600 308 / 6e-109 rotamase CYP 3 (.1.2) Lus10013552 [exp] 262 / 1e-90 AT2G16600 297 / 1e-104 rotamase CYP 3 (.1.2) Lus10042553 [exp] 249 / 1e-85 AT3G56070 297 / 1e-104 rotamase cyclophilin 2 (.1.2) Lus10022012 [exp] 245 / 6e-84 AT3G56070 295 / 1e-103 rotamase cyclophilin 2 (.1.2) Lus10040666 [exp] 220 / 1e-73 AT5G58710 347 / 2e-123 rotamase CYP 7 (.1) Lus10018238 [exp] 220 / 1e-73 AT2G29960 348 / 4e-124 CYCLOPHILIN 19-4, ARABIDOPSIS THALIANA CYCLOPHILIN 5, cyclophilin 5 (.1.2) Lus10014846 [exp] 215 / 9e-71 AT2G29960 310 / 6e-107 CYCLOPHILIN 19-4, ARABIDOPSIS THALIANA CYCLOPHILIN 5, cyclophilin 5 (.1.2) Lus10038315 [exp] 203 / 8e-67 AT2G29960 313 / 1e-109 CYCLOPHILIN 19-4, ARABIDOPSIS THALIANA CYCLOPHILIN 5, cyclophilin 5 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0475 [poplar] [flax] Cyclophil-like PF00160 [poplar] [flax] Pro_isomerase Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD
Representative CDS sequence Show only first row Show all	>Potri.004G168800.1 pacid=42796019 polypeptide=Potri.004G168800.1.p locus=Potri.004G168800 ID=Potri.004G168800.1.v4.1 annot-version=v4.1 ATGTCAAATCCTAAGGTATTCTTTGACATGACCGTCGGCGGCCAATCTGTTGGTCGGATCGTTATGGAGCTGTTCGCCGATATTGTTCCAAGGACAGCCG AGAATTTCCGTGCTCTTTGCACCGGTGAGAAAGGTGTTGGCAAGTCCGGCAAGCCACTTCACTTCAAAGGTTCAAGCTTTCACCGTGTGATCCCTAACTT CATGTGCCAAGGTGGTGACTTCACCGCCGGAAACGGCACCGGCGGTGAATCAATCTATGGGGCTAAGTTTGCCGATGAGAACTTCGTGAAGAAGCACACT GGACCTGGTGTGCTTTCCATGGCTAATGCCGGTCCTGGGACTAATGGATCTCAGTTCTTTGTCTGCACTGTTAAGACCGAATGGCTTGACGGGAAACATG TCGTTTTCGGCCAGGTTGTTGAAGGGATGGACGTGGTGAAGGCAATTGAGAAGGTTGGATCTGGAAATGGCAGGACTTCGAAGCCTGTTGTTGTTGCTGA CTGTGGTCAACTCTCTTAG
AA sequence Show only first row Show all	>Potri.004G168800.1 pacid=42796019 polypeptide=Potri.004G168800.1.p locus=Potri.004G168800 ID=Potri.004G168800.1.v4.1 annot-version=v4.1 MSNPKVFFDMTVGGQSVGRIVMELFADIVPRTAENFRALCTGEKGVGKSGKPLHFKGSSFHRVIPNFMCQGGDFTAGNGTGGESIYGAKFADENFVKKHT GPGVLSMANAGPGTNGSQFFVCTVKTEWLDGKHVVFGQVVEGMDVVKAIEKVGSGNGRTSKPVVVADCGQLS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G16600		ROC3	rotamase CYP 3 (.1.2)		Potri.004G168800 [exp]	0	1	VCCYP.1
AT3G17365			S-adenosyl-L-methionine-depend...		Potri.010G153200 [exp]	2.00	0.9048
AT4G22860			Cell cycle regulated microtubu...		Potri.012G130300 [exp]	4.24	0.8730
AT2G34770		ATFAH1, FAH1	ARABIDOPSIS FATTY ACID HYDROXY...		Potri.011G162000 [exp]	6.32	0.9071	Pt-FAH1.1
AT4G03210		XTH9, EXGT-A6, ...	xyloglucan endotransglucosylas...		Potri.019G125000 [exp]	8.06	0.8690	Pt-XTH9.1
AT4G34960			Cyclophilin-like peptidyl-prol...		Potri.004G173500 [exp]	8.94	0.8683
AT2G36830		TIP1;1, GAMMA-T...	TONOPLAST INTRINSIC PROTEIN 1;...		Potri.006G121700 [exp]	8.94	0.8873	Pt-TIP2.7
AT5G57290			60S acidic ribosomal protein f...		Potri.009G032600 [exp]	13.85	0.8958
AT2G44620		MTACP1, MTACP-1	mitochondrial acyl carrier pro...		Potri.002G135600 [exp]	15.68	0.8819
AT3G05030		ATNHX2, NHX2	sodium hydrogen exchanger 2 (....		Potri.010G031500 [exp]	15.90	0.8716	Pt-NHX1.1
AT4G08685		SAH7	Pollen Ole e 1 allergen and ex...		Potri.002G093100 [exp]	19.74	0.8828	Pt-SAH7.1

Compare expression of checked genes

Potri.004G168800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.