Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G14460 41 / 0.0002 LRR and NB-ARC domains-containing disease resistance protein (.1) AT1G58410 39 / 0.0006 Disease resistance protein (CC-NBS-LRR class) family (.1) AT5G43470 39 / 0.0007 HRT, RCY1, RPP8 RECOGNITION OF PERONOSPORA PARASITICA 8, RESISTANT TO CMV\(Y\) 1, HYPERSENSITIVE RESPONSE TO TCV, Disease resistance protein (CC-NBS-LRR class) family (.1), Disease resistance protein (CC-NBS-LRR class) family (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G003350 [exp] 263 / 6e-91 AT3G14470 60 / 3e-10 NB-ARC domain-containing disease resistance protein (.1) Potri.014G003832 [exp] 265 / 3e-83 AT3G14470 370 / 1e-109 NB-ARC domain-containing disease resistance protein (.1) Potri.014G002900 [exp] 264 / 1e-82 AT3G14470 397 / 2e-119 NB-ARC domain-containing disease resistance protein (.1) Potri.014G005300 [exp] 211 / 1e-68 AT5G48620 91 / 1e-19 Disease resistance protein (CC-NBS-LRR class) family (.1) Potri.013G041800 [exp] 223 / 2e-68 AT3G14470 325 / 2e-94 NB-ARC domain-containing disease resistance protein (.1) Potri.004G170300 [exp] 221 / 5e-68 AT3G14470 401 / 3e-123 NB-ARC domain-containing disease resistance protein (.1) Potri.014G003200 [exp] 216 / 8e-66 AT3G14470 352 / 4e-103 NB-ARC domain-containing disease resistance protein (.1) Potri.004G170400 [exp] 214 / 7e-65 AT3G14470 401 / 3e-121 NB-ARC domain-containing disease resistance protein (.1) Potri.014G003600 [exp] 213 / 2e-64 AT3G14470 388 / 2e-115 NB-ARC domain-containing disease resistance protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005218 [exp] 70 / 2e-14 AT3G14470 379 / 2e-113 NB-ARC domain-containing disease resistance protein (.1) Lus10042117 [exp] 60 / 7e-11 AT3G14470 354 / 2e-105 NB-ARC domain-containing disease resistance protein (.1) Lus10016316 [exp] 57 / 6e-10 AT3G14470 494 / 6e-156 NB-ARC domain-containing disease resistance protein (.1) Lus10028279 [exp] 55 / 2e-09 AT3G14470 337 / 5e-99 NB-ARC domain-containing disease resistance protein (.1) Lus10039509 [exp] 54 / 4e-09 AT3G14460 613 / 0.0 LRR and NB-ARC domains-containing disease resistance protein (.1) Lus10002736 [exp] 54 / 4e-09 AT3G14470 317 / 1e-98 NB-ARC domain-containing disease resistance protein (.1) Lus10039540 [exp] 53 / 2e-08 AT3G14470 727 / 0.0 NB-ARC domain-containing disease resistance protein (.1) Lus10022900 [exp] 52 / 2e-08 AT3G14470 350 / 2e-104 NB-ARC domain-containing disease resistance protein (.1) Lus10022351 [exp] 51 / 6e-08 AT3G14470 369 / 1e-108 NB-ARC domain-containing disease resistance protein (.1) Lus10007261 [exp] 51 / 6e-08 AT3G14460 654 / 0.0 LRR and NB-ARC domains-containing disease resistance protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.004G170000.1 pacid=42794987 polypeptide=Potri.004G170000.1.p locus=Potri.004G170000 ID=Potri.004G170000.1.v4.1 annot-version=v4.1 ATGGCAGTAGAGCTTCTTCTTACGTTTACCATGGAGGAGACTTTGACAAGGGTCAGTTCCATAGCTGCTGAAGGGATCAGACTTGCTTGGGGATTGGAGG GACAGCTGCGAAAGCTCAAGCAGTCCTCGATCATAATCAGAGATGTGCTCCATGATGCAGCAAGAAGGTCAGTCATAGACGATTCTGTGAAGGGTTGGCT GGAGAAACTACAAGATGTAGCTTACGATGCTGAAGATGTTCTAGACGAGTTTGCTTATGAGATTCTCCGAAAAGACCAAAAGAAGGGAAAGGTACGTGAC TGCTTTTCACTCCACAACCCTGTCGCATTCCGTCTGAATATGGGTCAAAAAGTTAAGGAGATCAATGGAGCACTGGATGAAATTCGAAAAGATGCAGCTG TATTTCAATTGACATCTCTACATGTAGATAGAGCTCAAGAAGTTAGCTGGGATTAA
AA sequence Show only first row Show all	>Potri.004G170000.1 pacid=42794987 polypeptide=Potri.004G170000.1.p locus=Potri.004G170000 ID=Potri.004G170000.1.v4.1 annot-version=v4.1 MAVELLLTFTMEETLTRVSSIAAEGIRLAWGLEGQLRKLKQSSIIIRDVLHDAARRSVIDDSVKGWLEKLQDVAYDAEDVLDEFAYEILRKDQKKGKVRD CFSLHNPVAFRLNMGQKVKEINGALDEIRKDAAVFQLTSLHVDRAQEVSWD

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G14470			NB-ARC domain-containing disea...		Potri.004G170000 [exp]	0	1
					Potri.004G080501 [exp]	3.00	0.8415
					Potri.001G444100 [exp]	3.74	0.8750
AT1G55790			Domain of unknown function (DU...		Potri.011G141700 [exp]	4.58	0.8516
AT4G32410		AtCESA1, RSW1, ...	RADIALLY SWOLLEN 1, cellulose ...		Potri.006G251900 [exp]	4.69	0.8285	Pt-CESA4.4
AT4G27190			NB-ARC domain-containing disea...		Potri.001G445150 [exp]	4.89	0.8683
AT3G53480		PIS1, ABCG37, P...	polar auxin transport inhibito...		Potri.010G153800 [exp]	4.89	0.8661
AT5G19790	AP2_ERF	RAP2.11	related to AP2 11 (.1)		Potri.008G091300 [exp]	5.00	0.8125
AT1G55790			Domain of unknown function (DU...		Potri.001G438100 [exp]	5.47	0.8631
					Potri.011G125251 [exp]	5.47	0.8557
AT4G27290			S-locus lectin protein kinase ...		Potri.011G126151 [exp]	6.48	0.8239

Compare expression of checked genes

Potri.004G170000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.