Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G78940 206 / 4e-63 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1.2) AT1G16760 192 / 1e-57 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) AT4G31230 190 / 1e-56 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) AT2G24370 188 / 5e-56 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) AT3G20200 182 / 6e-54 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) AT1G17540 176 / 9e-52 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) AT1G72760 176 / 1e-51 Protein kinase superfamily protein (.1) AT5G35380 173 / 1e-50 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) AT5G26150 172 / 2e-50 protein kinase family protein (.1) AT5G12000 171 / 4e-50 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G170742 [exp] 384 / 4e-130 AT1G78940 786 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1.2) Potri.014G001700 [exp] 371 / 2e-125 AT1G78940 783 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1.2) Potri.007G001900 [exp] 272 / 2e-87 AT1G78940 757 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1.2) Potri.006G078500 [exp] 196 / 3e-59 AT2G24370 824 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Potri.018G002400 [exp] 185 / 8e-55 AT2G24370 956 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Potri.018G061600 [exp] 174 / 5e-51 AT5G12000 714 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Potri.006G225300 [exp] 172 / 5e-50 AT5G12000 749 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Potri.001G198300 [exp] 172 / 7e-50 AT5G12000 639 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Potri.004G233000 [exp] 130 / 3e-35 AT4G25160 874 / 0.0 U-box domain-containing protein kinase family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10035712 [exp] 206 / 4e-64 AT1G16760 624 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Lus10033340 [exp] 210 / 1e-63 AT1G16760 800 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Lus10037298 [exp] 204 / 9e-62 AT1G16760 820 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Lus10027593 [exp] 189 / 6e-58 AT2G24370 665 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Lus10020185 [exp] 187 / 7e-57 AT2G24370 741 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Lus10040573 [exp] 189 / 3e-56 AT2G24370 815 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Lus10021596 [exp] 189 / 3e-56 AT2G24370 828 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Lus10026989 [exp] 186 / 6e-55 AT2G24370 1014 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Lus10024212 [exp] 185 / 8e-55 AT2G24370 780 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) Lus10008542 [exp] 184 / 2e-54 AT2G24370 823 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0016 [poplar] [flax] PKinase PF00069 [poplar] [flax] Pkinase Protein kinase domain
Representative CDS sequence Show only first row Show all	>Potri.004G170943.1 pacid=42795616 polypeptide=Potri.004G170943.1.p locus=Potri.004G170943 ID=Potri.004G170943.1.v4.1 annot-version=v4.1 ATGACATCAGCTGCTGGAACTTTCTGCTATATTGATCCAGAGTATCAACAAACTGGAATGCTTGGTGTGAAATCTGATGTATATTCCTTAGGGATCTTGC TTCTGCAAGTCATAACAGCCAAGCCACCAATGGGCTTGACTCACATTGTTGAACAAGCAATTGAAAATGAGACGCTCAAAGAAGTTCTAGACTCAGATGT GCCTGATTGGCCAATTGAAGAGACTTTATGGTTTGCAAAGCTTGCACTCCAATGTGCAGAACTGAGACGGAAAGACAGGCCAGATCTTGGCACAGAAGTC TTGCCAGAGCTCAACAGACTGAGAGATTATGCTGAAGAAAAGATGAACTACCTTTTTTTAGCTAAAGCTTTCGGCCCCTCCCCCAACCACAGCCTAGCTT CAATAACTCTTCCCATCAGCCAAATCTCAATAACTCCCACCAACCTTAGCCAACCTTCTGCAACTCCCACCAACCTCAGTCAAGTTTCAATAACTCAGGA AGCAATGAGCAATACTGTAGTTGGAAATCTAGGAAGCCCGAAGAGCCAATCAAGCAGTTAA
AA sequence Show only first row Show all	>Potri.004G170943.1 pacid=42795616 polypeptide=Potri.004G170943.1.p locus=Potri.004G170943 ID=Potri.004G170943.1.v4.1 annot-version=v4.1 MTSAAGTFCYIDPEYQQTGMLGVKSDVYSLGILLLQVITAKPPMGLTHIVEQAIENETLKEVLDSDVPDWPIEETLWFAKLALQCAELRRKDRPDLGTEV LPELNRLRDYAEEKMNYLFLAKAFGPSPNHSLASITLPISQISITPTNLSQPSATPTNLSQVSITQEAMSNTVVGNLGSPKSQSSS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G78940			Protein kinase protein with ad...		Potri.004G170943 [exp]	0	1
					Potri.004G015401 [exp]	1.00	0.8344
AT1G04570			Major facilitator superfamily ...		Potri.008G173600 [exp]	8.06	0.8042
					Potri.012G052502 [exp]	10.39	0.8242
					Potri.009G089900 [exp]	11.53	0.6664
AT1G72830	CCAAT	NF-YA3, ATHAP2C...	"nuclear factor Y, subunit A3"...		Potri.018G064700 [exp]	19.79	0.7717
AT1G13120		EMB1745	embryo defective 1745 (.1)		Potri.008G183500 [exp]	20.04	0.7985
					Potri.004G183401 [exp]	21.90	0.7549
AT5G06440			unknown protein		Potri.006G201000 [exp]	22.36	0.7488
					Potri.019G059350 [exp]	24.81	0.7900
AT4G32640			Sec23/Sec24 protein transport ...		Potri.002G082900 [exp]	26.40	0.7600

Compare expression of checked genes

Potri.004G170943 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.