Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-ADF5.2
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G16700 255 / 4e-89 ADF5, ATADF5 actin depolymerizing factor 5 (.1.2) AT4G34970 245 / 3e-85 ADF9 actin depolymerizing factor 9 (.1) AT2G31200 191 / 1e-63 ADF6, ATADF6 actin depolymerizing factor 6 (.1) AT4G00680 187 / 5e-62 ADF8 actin depolymerizing factor 8 (.1) AT1G01750 179 / 3e-59 ADF11 actin depolymerizing factor 11 (.1) AT3G46010 177 / 5e-58 ATADF1, ADF1 actin depolymerizing factor 1 (.1.2) AT5G59890 176 / 1e-57 ADF4, ATADF4 actin depolymerizing factor 4 (.1.2) AT4G25590 176 / 1e-57 ADF7 actin depolymerizing factor 7 (.1) AT5G59880 169 / 3e-55 ADF3 actin depolymerizing factor 3 (.1.2) AT3G46000 168 / 1e-54 ADF2 actin depolymerizing factor 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G133100 [exp] 289 / 1e-102 AT2G16700 257 / 7e-90 actin depolymerizing factor 5 (.1.2) Potri.005G223800 [exp] 198 / 2e-66 AT2G31200 225 / 5e-77 actin depolymerizing factor 6 (.1) Potri.002G038800 [exp] 189 / 1e-62 AT2G31200 241 / 2e-83 actin depolymerizing factor 6 (.1) Potri.001G236700 [exp] 179 / 5e-59 AT5G59890 256 / 2e-89 actin depolymerizing factor 4 (.1.2) Potri.009G028200 [exp] 178 / 9e-59 AT5G59890 258 / 4e-90 actin depolymerizing factor 4 (.1.2) Potri.008G052100 [exp] 178 / 9e-59 AT5G59890 249 / 1e-86 actin depolymerizing factor 4 (.1.2) Potri.001G236400 [exp] 177 / 3e-58 AT5G59890 246 / 1e-85 actin depolymerizing factor 4 (.1.2) Potri.015G144500 [exp] 177 / 4e-58 AT4G25590 257 / 6e-90 actin depolymerizing factor 7 (.1) Potri.009G028100 [exp] 176 / 5e-58 AT5G59890 256 / 1e-89 actin depolymerizing factor 4 (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025049 [exp] 254 / 1e-88 AT2G16700 232 / 9e-80 actin depolymerizing factor 5 (.1.2) Lus10034494 [exp] 216 / 9e-74 AT4G34970 202 / 2e-68 actin depolymerizing factor 9 (.1) Lus10022933 [exp] 197 / 8e-66 AT2G31200 254 / 9e-89 actin depolymerizing factor 6 (.1) Lus10024885 [exp] 190 / 2e-63 AT2G31200 230 / 3e-79 actin depolymerizing factor 6 (.1) Lus10024418 [exp] 187 / 6e-62 AT5G59890 249 / 6e-87 actin depolymerizing factor 4 (.1.2) Lus10024417 [exp] 183 / 2e-60 AT3G46010 250 / 3e-87 actin depolymerizing factor 1 (.1.2) Lus10025319 [exp] 183 / 2e-60 AT3G46010 250 / 3e-87 actin depolymerizing factor 1 (.1.2) Lus10008489 [exp] 179 / 1e-58 AT1G01750 192 / 2e-64 actin depolymerizing factor 11 (.1) Lus10023428 [exp] 170 / 1e-52 AT5G59890 244 / 4e-81 actin depolymerizing factor 4 (.1.2) Lus10027474 [exp] 163 / 1e-52 AT5G52360 244 / 6e-85 actin depolymerizing factor 10 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0092 [poplar] [flax] ADF PF00241 [poplar] [flax] Cofilin_ADF Cofilin/tropomyosin-type actin-binding protein
Representative CDS sequence Show only first row Show all	>Potri.004G173800.1 pacid=42794888 polypeptide=Potri.004G173800.1.p locus=Potri.004G173800 ID=Potri.004G173800.1.v4.1 annot-version=v4.1 ATGGCAATGGCTTTCAAGATGGCAACGACAGGCATGTGGGTAACTGATGAATGCAAGAACTCATTCCATGAAATGAAATGGAGAAAAGTTCATAGGTACA TAGTGTTCAAGATTGATGAGAAGTCGAGATTGGTAACTGTGGACAAGGTTGGTGGCCCTGGTGAAGGCTATGACGATCTTGCTGCTTCATTGCCAGATGA TGATTGCAGATATGCTGTGTTCGATTTCGATTTTGTCACTGTTGACAATTGCCGGAAGAGCAAGATCTTCTTCATCGCATGGGCTCCAACAGCATCGAGA ATCAGAGCAAAAATGCTTTATGCAACCTCCAAAGATGGACTGAGGAGAGTTCTTGAAGGCGTCCACTATGAACTCCAAGCAACCGACCCAACTGAGATGG GATTTGATTTGATAAGGGACCGAGCCAAGTAA
AA sequence Show only first row Show all	>Potri.004G173800.1 pacid=42794888 polypeptide=Potri.004G173800.1.p locus=Potri.004G173800 ID=Potri.004G173800.1.v4.1 annot-version=v4.1 MAMAFKMATTGMWVTDECKNSFHEMKWRKVHRYIVFKIDEKSRLVTVDKVGGPGEGYDDLAASLPDDDCRYAVFDFDFVTVDNCRKSKIFFIAWAPTASR IRAKMLYATSKDGLRRVLEGVHYELQATDPTEMGFDLIRDRAK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G16700		ADF5, ATADF5	actin depolymerizing factor 5 ...		Potri.004G173800 [exp]	0	1	Pt-ADF5.2
AT1G75840		ATROP4, ATGP3, ...	RHO-LIKE GTP BINDING PROTEIN 4...		Potri.019G092300 [exp]	2.23	0.9208
AT5G01090			Concanavalin A-like lectin fam...		Potri.006G094900 [exp]	3.46	0.9005
AT3G13130			unknown protein		Potri.001G366500 [exp]	3.74	0.9154
AT5G19450		CPK8, CDPK19	calcium-dependent protein kina...		Potri.009G052700 [exp]	7.21	0.8996	CPK7.1
AT2G33990		IQD9	IQ-domain 9 (.1)		Potri.004G053000 [exp]	7.74	0.9091
AT5G12250		TUB6	beta-6 tubulin (.1)		Potri.006G035400 [exp]	9.00	0.9145	TUB17,TUB6.1
AT1G48880		TBL7	TRICHOME BIREFRINGENCE-LIKE 7 ...		Potri.002G071900 [exp]	10.77	0.9107
AT3G08500	MYB	ATMYB83	myb domain protein 83 (.1)		Potri.009G061500 [exp]	12.24	0.8967
AT3G58460		ATRBL15	RHOMBOID-like protein 15 (.1.2...		Potri.006G197900 [exp]	12.48	0.9083
					Potri.011G057400 [exp]	18.97	0.9025

Compare expression of checked genes

Potri.004G173800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.