Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G77380 38 / 0.0008 AAP3, ATAAP3 amino acid permease 3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G133600 [exp] 74 / 3e-16 AT5G09220 711 / 0.0 amino acid permease 2 (.1) Potri.002G079500 [exp] 46 / 9e-07 AT1G77380 766 / 0.0 amino acid permease 3 (.1) Potri.005G068900 [exp] 45 / 3e-06 AT5G09220 799 / 0.0 amino acid permease 2 (.1) Potri.002G079700 [exp] 45 / 3e-06 AT1G77380 756 / 0.0 amino acid permease 3 (.1) Potri.005G181500 [exp] 41 / 5e-05 AT1G77380 728 / 0.0 amino acid permease 3 (.1) Potri.002G080066 [exp] 41 / 5e-05 AT1G77380 751 / 0.0 amino acid permease 3 (.1) Potri.002G079400 [exp] 40 / 0.0001 AT1G77380 765 / 0.0 amino acid permease 3 (.1) Potri.005G181600 [exp] 39 / 0.0004 AT1G77380 746 / 0.0 amino acid permease 3 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028546 [exp] 39 / 0.0005 AT1G77380 552 / 0.0 amino acid permease 3 (.1) Lus10018852 [exp] 39 / 0.0005 AT1G77380 702 / 0.0 amino acid permease 3 (.1) Lus10029702 [exp] 38 / 0.0009 AT1G77380 706 / 0.0 amino acid permease 3 (.1) Lus10010580 [exp] 38 / 0.001 AT5G23810 547 / 0.0 amino acid permease 7 (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.004G174150.1 pacid=42794235 polypeptide=Potri.004G174150.1.p locus=Potri.004G174150 ID=Potri.004G174150.1.v4.1 annot-version=v4.1 ATGCATGGGCTATGCAGCTTTTGTAAATTATGCCCCAGGAAATCTTTTGACTGGCTTTGGATTCTACAACCCCTGTTGGCTATTAGACATTGTCAATGTT GCAATCGTCGTTCACCTTGTTGGTGCCTATCAGGTCTAGTGCCCATCGAGATGTATATTTCTCAGAAGAAGATTGGGCGATGGACGAGCCAGTGGCTGGC TAGGGCTTCAGATTTTCAGTATGAGTTGCCTCGTGATCACCATAGCTGCAGCTTGTTGGCTCTGTTGCCGGGATTGTGTTGGATCTCTAAACTTACAAGC CATGCATTTAAATCTAGTTACCGAGGTCTGAGAGAGAGAGCTATGAATTGA
AA sequence Show only first row Show all	>Potri.004G174150.1 pacid=42794235 polypeptide=Potri.004G174150.1.p locus=Potri.004G174150 ID=Potri.004G174150.1.v4.1 annot-version=v4.1 MHGLCSFCKLCPRKSFDWLWILQPLLAIRHCQCCNRRSPCWCLSGLVPIEMYISQKKIGRWTSQWLARASDFQYELPRDHHSCSLLALLPGLCWISKLTS HAFKSSYRGLRERAMN

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G77380		AAP3, ATAAP3	amino acid permease 3 (.1)		Potri.004G174150 [exp]	0	1
AT5G44870		TTR1, LAZ5	tolerance to Tobacco ringspot ...		Potri.006G282700 [exp]	8.30	0.8345
AT5G36930			Disease resistance protein (TI...		Potri.011G008228 [exp]	26.94	0.8226
AT5G36930			Disease resistance protein (TI...		Potri.011G015400 [exp]	31.17	0.8031
AT5G45230			Disease resistance protein (TI...		Potri.019G098550 [exp]	35.09	0.7753
AT1G23870		ATTPS9	TREHALOSE -6-PHOSPHATASE SYNTH...		Potri.012G078500 [exp]	40.24	0.7737	Pt-TPS8.1
AT3G14470			NB-ARC domain-containing disea...		Potri.017G127800 [exp]	46.43	0.7643
AT5G36930			Disease resistance protein (TI...		Potri.011G008740 [exp]	54.79	0.7464
AT3G14470			NB-ARC domain-containing disea...		Potri.017G127651 [exp]	55.04	0.7808
AT1G09240		ATNAS3	ARABIDOPSIS THALIANA NICOTIANA...		Potri.010G143100 [exp]	56.68	0.7316
AT5G01750			Protein of unknown function (D...		Potri.016G131850 [exp]	66.82	0.7034

Compare expression of checked genes

Potri.004G174150 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.