Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	UBC.11
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G53300 292 / 2e-103 UBC10 ubiquitin-conjugating enzyme 10 (.1.2.3.4) AT1G64230 292 / 2e-103 UBC28 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) AT4G27960 291 / 4e-103 UBC9 ubiquitin conjugating enzyme 9 (.1.2) AT5G41700 288 / 9e-102 ATUBC8, UBC8 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5) AT3G08690 282 / 2e-99 ATUBC11, UBC11 ubiquitin-conjugating enzyme 11 (.1.2) AT5G56150 276 / 3e-97 UBC30 ubiquitin-conjugating enzyme 30 (.1.2) AT2G16740 276 / 4e-97 UBC29 ubiquitin-conjugating enzyme 29 (.1) AT3G08700 245 / 7e-85 UBC12 ubiquitin-conjugating enzyme 12 (.1) AT3G13550 160 / 5e-51 EMB144, COP10, CIN4, FUS9 FUSCA 9, EMBRYO DEFECTIVE 144, CONSTITUTIVE PHOTOMORPHOGENIC 10, CYTOKININ-INSENSITIVE 4, Ubiquitin-conjugating enzyme family protein (.1.2) AT1G16890 149 / 6e-47 UBC36 ,UBC13B UBIQUITIN CONJUGATING ENZYME 13B, ubiquitin-conjugating enzyme 36 (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G136200 [exp] 291 / 4e-103 AT1G64230 304 / 4e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Potri.006G110200 [exp] 291 / 4e-103 AT5G41700 304 / 4e-108 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5) Potri.016G138900 [exp] 291 / 6e-103 AT1G64230 304 / 3e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Potri.019G131400 [exp] 290 / 9e-103 AT5G41700 304 / 4e-108 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5) Potri.001G094900 [exp] 290 / 9e-103 AT1G64230 302 / 2e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Potri.012G033000 [exp] 290 / 2e-102 AT5G53300 302 / 1e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4) Potri.015G023300 [exp] 290 / 2e-102 AT5G53300 302 / 1e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4) Potri.001G471200 [exp] 281 / 3e-99 AT1G64230 292 / 2e-103 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Potri.011G168200 [exp] 280 / 2e-98 AT1G64230 295 / 1e-104 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027846 [exp] 296 / 4e-105 AT1G64230 289 / 3e-102 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10032352 [exp] 290 / 2e-102 AT5G53300 302 / 2e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4) Lus10039323 [exp] 289 / 3e-102 AT1G64230 303 / 8e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10027570 [exp] 289 / 3e-102 AT1G64230 303 / 8e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10022726 [exp] 289 / 4e-102 AT1G64230 303 / 7e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10014187 [exp] 289 / 4e-102 AT1G64230 303 / 7e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10014942 [exp] 288 / 6e-102 AT1G64230 301 / 3e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10038827 [exp] 288 / 6e-102 AT1G64230 301 / 3e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10033937 [exp] 286 / 3e-101 AT5G53300 300 / 2e-106 ubiquitin-conjugating enzyme 10 (.1.2.3.4) Lus10005072 [exp] 296 / 1e-100 AT4G27960 291 / 3e-98 ubiquitin conjugating enzyme 9 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0208 [poplar] [flax] UBC PF00179 [poplar] [flax] UQ_con Ubiquitin-conjugating enzyme
Representative CDS sequence Show only first row Show all	>Potri.004G175000.2 pacid=42796676 polypeptide=Potri.004G175000.2.p locus=Potri.004G175000 ID=Potri.004G175000.2.v4.1 annot-version=v4.1 ATGGCATCGAAAAGAATATTGAAGGAGCTCAAGGACTTGCAGAGAGATCCCCCAACTTCATGCAGTGCAGGTCCTGTGGCTGAGGATATGTTCCATTGGC AAGCCACCATCATAGGTCCAAATGACAGTCCCTATGCCGGTGGTGTTTTCCTTGTTACCATTCATTTCCCACCGGATTATCCTTTTAAACCTCCCAAGGT TGCCTTCAGGACCAAGGTATTCCATCCAAACATAAACAGTAACGGGAACATCTGCTTGGACATACTCAAGGAACAATGGAGCCCTGCGCTCACCATATCA AAGGTTTTACTCTCCATATGCTCACTGCTTACAGATCCAAACCCTGATGATCCTCTTGTTCCTGAAATAGCCCATATGTGCAAGGCCGACAAGATCAAGT ATGAGTCTTCTGCTAGGAGCTGGACTCAAAAGTATGCCATGGGATAG
AA sequence Show only first row Show all	>Potri.004G175000.2 pacid=42796676 polypeptide=Potri.004G175000.2.p locus=Potri.004G175000 ID=Potri.004G175000.2.v4.1 annot-version=v4.1 MASKRILKELKDLQRDPPTSCSAGPVAEDMFHWQATIIGPNDSPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGNICLDILKEQWSPALTIS KVLLSICSLLTDPNPDDPLVPEIAHMCKADKIKYESSARSWTQKYAMG

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G53300		UBC10	ubiquitin-conjugating enzyme 1...		Potri.004G175000 [exp]	0	1	UBC.11
AT1G10155		ATPP2-A10	phloem protein 2-A10 (.1)		Potri.015G120200 [exp]	2.00	0.8896
AT5G57580			Calmodulin-binding protein (.1...		Potri.004G035100 [exp]	5.74	0.8833
AT2G38970			Zinc finger (C3HC4-type RING f...		Potri.001G082150 [exp]	7.54	0.8988
AT1G47890		AtRLP7	receptor like protein 7 (.1)		Potri.012G020895 [exp]	11.83	0.8518
AT1G10940		ASK1, SNRK2-4, ...	SNF1-related protein kinase 2....		Potri.004G138300 [exp]	14.07	0.8647	SPK.2
					Potri.012G140067 [exp]	15.09	0.8197
AT4G31970		CYP82C2, JAH1	"cytochrome P450, family 82, s...		Potri.001G334700 [exp]	15.19	0.8575
AT5G06800	GARP		myb-like HTH transcriptional r...		Potri.006G191000 [exp]	15.42	0.8442
AT1G10690			unknown protein		Potri.010G045200 [exp]	16.24	0.8495
					Potri.014G013800 [exp]	19.59	0.8305

Compare expression of checked genes

Potri.004G175000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.