Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G35070 142 / 1e-41 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) AT3G12920 89 / 2e-20 BRG3 BOI-related gene 3, SBP (S-ribonuclease binding protein) family protein (.1) AT1G45976 87 / 1e-19 SBP1 S-ribonuclease binding protein 1 (.1) AT1G32740 82 / 7e-18 SBP (S-ribonuclease binding protein) family protein (.1) AT5G45100 81 / 1e-17 BRG1 BOI-related gene 1, SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) AT1G79110 74 / 5e-15 BRG2 BOI-related gene 2, zinc ion binding (.1.2) AT4G19700 70 / 8e-14 BOI, RING Botrytis Susceptible1 Interactor, SBP (S-ribonuclease binding protein) family protein (.1) AT1G60610 69 / 2e-13 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2), SBP (S-ribonuclease binding protein) family protein (.3) AT4G17680 66 / 2e-12 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) AT5G47050 63 / 2e-11 SBP (S-ribonuclease binding protein) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G135400 [exp] 333 / 6e-116 AT4G35070 135 / 6e-39 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) Potri.005G242600 [exp] 139 / 1e-39 AT4G35070 135 / 3e-38 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) Potri.002G019000 [exp] 134 / 1e-37 AT4G35070 148 / 6e-43 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) Potri.014G027000 [exp] 97 / 3e-23 AT1G45976 380 / 2e-132 S-ribonuclease binding protein 1 (.1) Potri.015G118000 [exp] 90 / 7e-21 AT5G45100 259 / 2e-85 BOI-related gene 1, SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) Potri.002G124700 [exp] 88 / 4e-20 AT1G45976 378 / 2e-131 S-ribonuclease binding protein 1 (.1) Potri.003G085800 [exp] 78 / 2e-16 AT1G32740 220 / 9e-70 SBP (S-ribonuclease binding protein) family protein (.1) Potri.012G119200 [exp] 77 / 5e-16 AT5G45100 244 / 1e-79 BOI-related gene 1, SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) Potri.010G042200 [exp] 74 / 4e-15 AT1G10650 393 / 2e-137 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019790 [exp] 196 / 1e-62 AT4G35070 170 / 1e-53 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) Lus10014118 [exp] 195 / 3e-62 AT4G35070 171 / 7e-54 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) Lus10013569 [exp] 101 / 5e-25 AT4G35070 125 / 1e-34 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) Lus10017276 [exp] 96 / 2e-23 AT4G35070 122 / 2e-34 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) Lus10031780 [exp] 87 / 1e-19 AT3G12920 260 / 3e-85 BOI-related gene 3, SBP (S-ribonuclease binding protein) family protein (.1) Lus10001131 [exp] 86 / 4e-19 AT1G45976 407 / 7e-143 S-ribonuclease binding protein 1 (.1) Lus10031202 [exp] 82 / 6e-18 AT3G12920 255 / 3e-83 BOI-related gene 3, SBP (S-ribonuclease binding protein) family protein (.1) Lus10018294 [exp] 81 / 2e-17 AT5G45100 266 / 3e-88 BOI-related gene 1, SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) Lus10030891 [exp] 79 / 7e-17 AT1G10650 275 / 1e-92 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) Lus10030597 [exp] 77 / 6e-16 AT1G10650 380 / 3e-132 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.004G175500.1 pacid=42795223 polypeptide=Potri.004G175500.1.p locus=Potri.004G175500 ID=Potri.004G175500.1.v4.1 annot-version=v4.1 ATGGCAATACAAGCACAGTTTCCATATTGTGGAGGGTCACAGGATTTGATGGATTATGGGTGTGGAGGTTTGAATCAGTACTTCAATGTTCAGCAACAAA AACAGCAGCTGCAGCAGCAATGCAACACGCATCAGTTACTAAATTATCAGCTTCAGAGGAATCAAAATCTTTTCTTTGACAGTACTCTTGCTTCTGCTTC GAAAAACAACAACAGTGATCATCTTTCAATGGGTACCATGGCCTCCTATGATGAGAAGCAAAGACAAGAGATTGATCACTATATCAGACTCCAGAACGAG AGACTGAGATTGGTGTTACAAGAGCAAAAAAGGCAGCAGCTTTCGTTATTGTTAAAGAAAGTAGAATCAAAGGCCCTGCCGATATTGAAACAAAAGGATG AAGAAATAGCACAGGCAGTTAAAAGAACGGTGGAGCTTGAAGATTTCTTGAAGAAATTAGAGTTCGAGAATCAAACATGGCAAAGAATGGCTCTAGAAAA TGAAGCCAAAGTTATTTCTCTCAACAACACAATTGAACAACTGAGAGAAAATGCATCTAGTTGTTTTAACAATGGGGCAGAGGATGCAGAGTCTTGCTGC GATGTTAGCAGAGAAGAGGAATGGTTTCTTGATGACGCTGATGATACGGCAAGAAAGATGGTGATGGTATGCAAGAGATGTAATTCTAGGAATTCGTGTA TTTTGTTCCTTCCTTGTAGGCACCTTTGCTCATGTAAAGCTTGTGATGCCTGTCTTGATGCTTGTCCAGTGTGTCAAACACCAAAGAAGGCTAGTATTGA GGCTTTAATGGTTTAG
AA sequence Show only first row Show all	>Potri.004G175500.1 pacid=42795223 polypeptide=Potri.004G175500.1.p locus=Potri.004G175500 ID=Potri.004G175500.1.v4.1 annot-version=v4.1 MAIQAQFPYCGGSQDLMDYGCGGLNQYFNVQQQKQQLQQQCNTHQLLNYQLQRNQNLFFDSTLASASKNNNSDHLSMGTMASYDEKQRQEIDHYIRLQNE RLRLVLQEQKRQQLSLLLKKVESKALPILKQKDEEIAQAVKRTVELEDFLKKLEFENQTWQRMALENEAKVISLNNTIEQLRENASSCFNNGAEDAESCC DVSREEEWFLDDADDTARKMVMVCKRCNSRNSCILFLPCRHLCSCKACDACLDACPVCQTPKKASIEALMV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G35070			SBP (S-ribonuclease binding pr...		Potri.004G175500 [exp]	0	1
AT4G16120		ATSEB1, COBL7	ARABIDOPSIS THALIANA SEC61 BET...		Potri.010G001100 [exp]	3.16	0.8513	ATSEB1.1
AT1G76160		SKS5	SKU5 similar 5 (.1)		Potri.005G247700 [exp]	4.89	0.8162
AT3G24630			unknown protein		Potri.018G082300 [exp]	6.24	0.8369
AT2G27080			Late embryogenesis abundant (L...		Potri.004G197600 [exp]	8.00	0.8424
AT5G57510			unknown protein		Potri.006G273500 [exp]	8.48	0.7875
AT5G57510			unknown protein		Potri.006G273566 [exp]	10.09	0.7384
AT4G25810		XTH23, XTR6	xyloglucan endotransglucosylas...		Potri.013G005700 [exp]	11.31	0.8039	Pt-XTH3.1
AT4G07960		ATCSLC12	CELLULOSE-SYNTHASE LIKE C12, C...		Potri.005G146900 [exp]	11.61	0.8170
AT1G76160		SKS5	SKU5 similar 5 (.1)		Potri.004G180500 [exp]	13.85	0.6404
AT5G64310		ATAGP1, AGP1	arabinogalactan protein 1 (.1)		Potri.001G310400 [exp]	14.07	0.7607

Compare expression of checked genes

Potri.004G175500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.