Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G39130 274 / 6e-94 RmlC-like cupins superfamily protein (.1) AT5G39190 273 / 1e-93 ATGER2, GLP2A GERMIN-LIKE PROTEIN 2A, A. THALIANA GERMIN LIKE PROTEIN 2, germin-like protein 2 (.1.2) AT5G39160 273 / 3e-93 RmlC-like cupins superfamily protein (.1.2.3) AT3G05950 263 / 2e-89 RmlC-like cupins superfamily protein (.1) AT5G39110 254 / 7e-86 RmlC-like cupins superfamily protein (.1) AT5G39150 250 / 1e-84 RmlC-like cupins superfamily protein (.1) AT5G39180 250 / 2e-84 RmlC-like cupins superfamily protein (.1) AT5G39120 249 / 7e-84 RmlC-like cupins superfamily protein (.1) AT3G04200 241 / 5e-81 RmlC-like cupins superfamily protein (.1) AT3G04170 232 / 2e-77 RmlC-like cupins superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G180100 [exp] 460 / 7e-167 AT5G39130 275 / 1e-93 RmlC-like cupins superfamily protein (.1) Potri.004G179800 [exp] 459 / 2e-166 AT5G39130 275 / 1e-93 RmlC-like cupins superfamily protein (.1) Potri.004G179811 [exp] 459 / 2e-166 AT5G39130 275 / 1e-93 RmlC-like cupins superfamily protein (.1) Potri.004G179900 [exp] 459 / 2e-166 AT5G39130 275 / 1e-93 RmlC-like cupins superfamily protein (.1) Potri.004G179844 [exp] 457 / 3e-166 AT5G39130 274 / 6e-94 RmlC-like cupins superfamily protein (.1) Potri.004G179833 [exp] 457 / 3e-166 AT5G39130 274 / 6e-94 RmlC-like cupins superfamily protein (.1) Potri.004G179888 [exp] 457 / 3e-166 AT5G39130 274 / 6e-94 RmlC-like cupins superfamily protein (.1) Potri.009G140350 [exp] 399 / 5e-143 AT5G39110 249 / 3e-84 RmlC-like cupins superfamily protein (.1) Potri.009G140400 [exp] 396 / 4e-142 AT5G39110 247 / 3e-83 RmlC-like cupins superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006538 [exp] 300 / 3e-104 AT5G39120 313 / 3e-109 RmlC-like cupins superfamily protein (.1) Lus10006536 [exp] 298 / 3e-103 AT5G39150 308 / 2e-107 RmlC-like cupins superfamily protein (.1) Lus10000622 [exp] 293 / 4e-101 AT5G39130 307 / 7e-107 RmlC-like cupins superfamily protein (.1) Lus10003267 [exp] 291 / 2e-100 AT5G39130 257 / 4e-87 RmlC-like cupins superfamily protein (.1) Lus10003116 [exp] 287 / 7e-99 AT5G39150 303 / 2e-105 RmlC-like cupins superfamily protein (.1) Lus10003114 [exp] 283 / 2e-97 AT5G39150 303 / 2e-105 RmlC-like cupins superfamily protein (.1) Lus10006543 [exp] 283 / 2e-97 AT5G39150 303 / 2e-105 RmlC-like cupins superfamily protein (.1) Lus10033767 [exp] 279 / 1e-95 AT5G39150 298 / 2e-103 RmlC-like cupins superfamily protein (.1) Lus10042517 [exp] 254 / 6e-86 AT5G39160 251 / 4e-85 RmlC-like cupins superfamily protein (.1.2.3) Lus10021980 [exp] 253 / 2e-85 AT5G39160 249 / 5e-84 RmlC-like cupins superfamily protein (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0029 [poplar] [flax] Cupin PF07883 [poplar] [flax] Cupin_2 Cupin domain
Representative CDS sequence Show only first row Show all	>Potri.004G179855.1 pacid=42794066 polypeptide=Potri.004G179855.1.p locus=Potri.004G179855 ID=Potri.004G179855.1.v4.1 annot-version=v4.1 ATGATGAAAGTTGCTAATTTGATAGCGGTTTTTATTCTCTTGGCTCTGGCTTCCTCATTTGTCACTGCCTATGACCCCAGCCCCCTCCAAGACTTCTGCG TAGCAATAGATGATGCTAATTCTGCTGTTCTTGTTAATGGAAAATTGTGTAAGAATCCAAGCCTCGCCACTCCTGATGATTTCTCGTACTCGGGGCTTGA TGTTCCTGGAAACACATCAAATCAACTTGGAGCACGTGTTAATATCATTACAGCCGATCTAATGCCTGGGCTTAACACTCTTGGCGTATCTTTAGCACGG ATAGACTTGGCGCCAAACGGTGGCCTAAACCCTCCACATTATCACCCCAGAGGATCGGAGGTTCTGCTGGTTTTGGAAGGCACTCTTTATGCTGGCTTTG TAACCTCAAATCCTGATCATCGTCTCTTTACCAAAATCCTAAAACCAGGAGATCTCTTTGTATTCCCATTCGGCCTCATTCATTTTCAATTGAATATTGG AAAGACTCCTGCCGTTGCTATTGCTGCATTAACAAGCCAAAATCCAGGAGTAAACACAGTAGCAAATGCAATCTTTGGAGCCAGTTGGCCTCTTTATCCT GAAGTTCTCACCACAGCATTCCATTTGGATGAAAAACTTGTGGAGGATCTCCAGAGTCAAGAATGGGTGAACCCTACATGA
AA sequence Show only first row Show all	>Potri.004G179855.1 pacid=42794066 polypeptide=Potri.004G179855.1.p locus=Potri.004G179855 ID=Potri.004G179855.1.v4.1 annot-version=v4.1 MMKVANLIAVFILLALASSFVTAYDPSPLQDFCVAIDDANSAVLVNGKLCKNPSLATPDDFSYSGLDVPGNTSNQLGARVNIITADLMPGLNTLGVSLAR IDLAPNGGLNPPHYHPRGSEVLLVLEGTLYAGFVTSNPDHRLFTKILKPGDLFVFPFGLIHFQLNIGKTPAVAIAALTSQNPGVNTVANAIFGASWPLYP EVLTTAFHLDEKLVEDLQSQEWVNPT

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G39130			RmlC-like cupins superfamily p...		Potri.004G179855 [exp]	0	1
AT5G39130			RmlC-like cupins superfamily p...		Potri.004G179844 [exp]	1.00	0.9704
AT5G39130			RmlC-like cupins superfamily p...		Potri.004G179833 [exp]	2.00	0.9427
AT5G39130			RmlC-like cupins superfamily p...		Potri.004G179900 [exp]	2.82	0.9115
AT5G39130			RmlC-like cupins superfamily p...		Potri.004G179888 [exp]	3.00	0.9296
AT1G74500	bHLH	TMO7, PRE3, ATB...	TARGET OF MONOPTEROS 7, activa...		Potri.012G069500 [exp]	3.16	0.6942
AT5G39130			RmlC-like cupins superfamily p...		Potri.004G179800 [exp]	3.87	0.8942	GER2.34
AT5G39130			RmlC-like cupins superfamily p...		Potri.004G179811 [exp]	7.41	0.6910
AT3G07970		QRT2	QUARTET 2, Pectin lyase-like s...		Potri.009G060400 [exp]	13.78	0.6330
AT1G30760			FAD-binding Berberine family p...		Potri.012G034700 [exp]	25.69	0.6784
AT5G50610			unknown protein		Potri.001G059800 [exp]	57.84	0.6822

Compare expression of checked genes

Potri.004G179855 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.