Potri.004G179888 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G39130 274 / 6e-94 RmlC-like cupins superfamily protein (.1)
AT5G39190 273 / 1e-93 ATGER2, GLP2A GERMIN-LIKE PROTEIN 2A, A. THALIANA GERMIN LIKE PROTEIN 2, germin-like protein 2 (.1.2)
AT5G39160 273 / 3e-93 RmlC-like cupins superfamily protein (.1.2.3)
AT3G05950 263 / 2e-89 RmlC-like cupins superfamily protein (.1)
AT5G39110 254 / 7e-86 RmlC-like cupins superfamily protein (.1)
AT5G39150 250 / 1e-84 RmlC-like cupins superfamily protein (.1)
AT5G39180 250 / 2e-84 RmlC-like cupins superfamily protein (.1)
AT5G39120 249 / 7e-84 RmlC-like cupins superfamily protein (.1)
AT3G04200 241 / 5e-81 RmlC-like cupins superfamily protein (.1)
AT3G04170 232 / 2e-77 RmlC-like cupins superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G180100 460 / 7e-167 AT5G39130 275 / 1e-93 RmlC-like cupins superfamily protein (.1)
Potri.004G179800 459 / 2e-166 AT5G39130 275 / 1e-93 RmlC-like cupins superfamily protein (.1)
Potri.004G179811 459 / 2e-166 AT5G39130 275 / 1e-93 RmlC-like cupins superfamily protein (.1)
Potri.004G179900 459 / 2e-166 AT5G39130 275 / 1e-93 RmlC-like cupins superfamily protein (.1)
Potri.004G179844 457 / 3e-166 AT5G39130 274 / 6e-94 RmlC-like cupins superfamily protein (.1)
Potri.004G179833 457 / 3e-166 AT5G39130 274 / 6e-94 RmlC-like cupins superfamily protein (.1)
Potri.004G179855 457 / 3e-166 AT5G39130 274 / 6e-94 RmlC-like cupins superfamily protein (.1)
Potri.009G140350 399 / 5e-143 AT5G39110 249 / 3e-84 RmlC-like cupins superfamily protein (.1)
Potri.009G140400 396 / 4e-142 AT5G39110 247 / 3e-83 RmlC-like cupins superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006538 300 / 3e-104 AT5G39120 313 / 3e-109 RmlC-like cupins superfamily protein (.1)
Lus10006536 298 / 3e-103 AT5G39150 308 / 2e-107 RmlC-like cupins superfamily protein (.1)
Lus10000622 293 / 4e-101 AT5G39130 307 / 7e-107 RmlC-like cupins superfamily protein (.1)
Lus10003267 291 / 2e-100 AT5G39130 257 / 4e-87 RmlC-like cupins superfamily protein (.1)
Lus10003116 287 / 7e-99 AT5G39150 303 / 2e-105 RmlC-like cupins superfamily protein (.1)
Lus10003114 283 / 2e-97 AT5G39150 303 / 2e-105 RmlC-like cupins superfamily protein (.1)
Lus10006543 283 / 2e-97 AT5G39150 303 / 2e-105 RmlC-like cupins superfamily protein (.1)
Lus10033767 279 / 1e-95 AT5G39150 298 / 2e-103 RmlC-like cupins superfamily protein (.1)
Lus10042517 254 / 6e-86 AT5G39160 251 / 4e-85 RmlC-like cupins superfamily protein (.1.2.3)
Lus10021980 253 / 2e-85 AT5G39160 249 / 5e-84 RmlC-like cupins superfamily protein (.1.2.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0029 Cupin PF07883 Cupin_2 Cupin domain
Representative CDS sequence
>Potri.004G179888.1 pacid=42794449 polypeptide=Potri.004G179888.1.p locus=Potri.004G179888 ID=Potri.004G179888.1.v4.1 annot-version=v4.1
ATGATGAAAGTTGCTAATTTGATAGCGGTTTTTATTCTCTTGGCTCTGGCTTCCTCATTTGTCACTGCCTATGACCCCAGCCCCCTCCAAGACTTCTGCG
TAGCAATAGATGATGCTAATTCTGCTGTTCTTGTTAATGGAAAATTGTGTAAGAATCCAAGCCTCGCCACTCCTGATGATTTCTCGTACTCGGGGCTTGA
TGTTCCTGGAAACACATCAAATCAACTTGGAGCACGTGTTAATATCATTACAGCCGATCTAATGCCTGGGCTTAACACTCTTGGCGTATCTTTAGCACGG
ATAGACTTGGCGCCAAACGGTGGCCTAAACCCTCCACATTATCACCCCAGAGGATCGGAGGTTCTGCTGGTTTTGGAAGGCACTCTTTATGCTGGCTTTG
TAACCTCAAATCCTGATCATCGTCTCTTTACCAAAATCCTAAAACCAGGAGATCTCTTTGTATTCCCATTCGGCCTCATTCATTTTCAATTGAATATTGG
AAAGACTCCTGCCGTTGCTATTGCTGCATTAACAAGCCAAAATCCAGGAGTAAACACAGTAGCAAATGCAATCTTTGGAGCCAGTTGGCCTCTTTATCCT
GAAGTTCTCACCACAGCATTCCATTTGGATGAAAAACTTGTGGAGGATCTCCAGAGTCAAGAATGGGTGAACCCTACATGA
AA sequence
>Potri.004G179888.1 pacid=42794449 polypeptide=Potri.004G179888.1.p locus=Potri.004G179888 ID=Potri.004G179888.1.v4.1 annot-version=v4.1
MMKVANLIAVFILLALASSFVTAYDPSPLQDFCVAIDDANSAVLVNGKLCKNPSLATPDDFSYSGLDVPGNTSNQLGARVNIITADLMPGLNTLGVSLAR
IDLAPNGGLNPPHYHPRGSEVLLVLEGTLYAGFVTSNPDHRLFTKILKPGDLFVFPFGLIHFQLNIGKTPAVAIAALTSQNPGVNTVANAIFGASWPLYP
EVLTTAFHLDEKLVEDLQSQEWVNPT

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G39130 RmlC-like cupins superfamily p... Potri.004G179888 0 1
AT5G39130 RmlC-like cupins superfamily p... Potri.004G179833 1.00 0.9501
AT5G39130 RmlC-like cupins superfamily p... Potri.004G179844 2.00 0.9498
AT5G39130 RmlC-like cupins superfamily p... Potri.004G179900 2.00 0.9120
AT5G39130 RmlC-like cupins superfamily p... Potri.004G179855 3.00 0.9296
AT5G39130 RmlC-like cupins superfamily p... Potri.004G179800 3.16 0.8957 GER2.34
AT5G43580 UPI UNUSUAL SERINE PROTEASE INHIBI... Potri.005G221000 18.00 0.7976
AT3G07970 QRT2 QUARTET 2, Pectin lyase-like s... Potri.009G060400 24.49 0.6576
AT5G50610 unknown protein Potri.001G059800 25.78 0.7410
AT5G39130 RmlC-like cupins superfamily p... Potri.004G179811 32.61 0.6621
AT4G12430 TPPF trehalose-6-phosphate phosphat... Potri.003G112400 38.85 0.7625

Potri.004G179888 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.