Potri.004G184300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G27580 156 / 4e-49 A20/AN1-like zinc finger family protein (.1.2)
AT3G52800 139 / 2e-42 A20/AN1-like zinc finger family protein (.1)
AT2G36320 138 / 5e-42 A20/AN1-like zinc finger family protein (.1)
AT1G12440 122 / 9e-36 A20/AN1-like zinc finger family protein (.1.2)
AT4G12040 122 / 2e-35 AtSAP7 stress-associated protein 7, A20/AN1-like zinc finger family protein (.1.2)
AT4G22820 119 / 1e-34 A20/AN1-like zinc finger family protein (.1.2)
AT1G51200 116 / 2e-33 A20/AN1-like zinc finger family protein (.1.2.3.4)
AT4G14225 92 / 2e-24 A20/AN1-like zinc finger family protein (.1)
AT3G12630 92 / 7e-24 SAP5 stress associated protein 5, A20/AN1-like zinc finger family protein (.1)
AT4G25380 89 / 5e-23 AtSAP10, SAP10 Arabidopsis thaliana stress-associated protein 10, stress-associated protein 10 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G144100 205 / 1e-68 AT2G27580 166 / 5e-53 A20/AN1-like zinc finger family protein (.1.2)
Potri.003G205500 138 / 6e-42 AT1G51200 202 / 4e-67 A20/AN1-like zinc finger family protein (.1.2.3.4)
Potri.016G051700 135 / 6e-41 AT1G51200 164 / 3e-52 A20/AN1-like zinc finger family protein (.1.2.3.4)
Potri.001G018600 134 / 2e-40 AT1G51200 203 / 2e-67 A20/AN1-like zinc finger family protein (.1.2.3.4)
Potri.006G056500 132 / 1e-39 AT1G51200 167 / 2e-53 A20/AN1-like zinc finger family protein (.1.2.3.4)
Potri.001G115000 120 / 6e-35 AT4G12040 169 / 4e-54 stress-associated protein 7, A20/AN1-like zinc finger family protein (.1.2)
Potri.003G117100 113 / 2e-32 AT1G12440 170 / 2e-54 A20/AN1-like zinc finger family protein (.1.2)
Potri.007G078500 108 / 2e-30 AT4G12040 120 / 6e-35 stress-associated protein 7, A20/AN1-like zinc finger family protein (.1.2)
Potri.001G269400 107 / 8e-30 AT3G12630 160 / 2e-50 stress associated protein 5, A20/AN1-like zinc finger family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10003246 143 / 4e-44 AT2G36320 201 / 3e-67 A20/AN1-like zinc finger family protein (.1)
Lus10020594 137 / 1e-41 AT2G36320 149 / 2e-46 A20/AN1-like zinc finger family protein (.1)
Lus10031833 126 / 2e-37 AT1G51200 186 / 5e-61 A20/AN1-like zinc finger family protein (.1.2.3.4)
Lus10006671 125 / 4e-37 AT1G12440 204 / 3e-68 A20/AN1-like zinc finger family protein (.1.2)
Lus10031262 123 / 4e-36 AT1G51200 187 / 2e-61 A20/AN1-like zinc finger family protein (.1.2.3.4)
Lus10007015 122 / 1e-35 AT1G12440 207 / 3e-69 A20/AN1-like zinc finger family protein (.1.2)
Lus10028903 121 / 4e-35 AT1G12440 205 / 3e-68 A20/AN1-like zinc finger family protein (.1.2)
Lus10008912 120 / 7e-35 AT1G12440 202 / 4e-67 A20/AN1-like zinc finger family protein (.1.2)
Lus10035603 108 / 6e-31 AT2G36320 152 / 3e-48 A20/AN1-like zinc finger family protein (.1)
Lus10015697 99 / 1e-26 AT3G12630 178 / 1e-57 stress associated protein 5, A20/AN1-like zinc finger family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01428 zf-AN1 AN1-like Zinc finger
PF01754 zf-A20 A20-like zinc finger
Representative CDS sequence
>Potri.004G184300.1 pacid=42795510 polypeptide=Potri.004G184300.1.p locus=Potri.004G184300 ID=Potri.004G184300.1.v4.1 annot-version=v4.1
ATGGCAGAAGAACAACACAGATGCCAAGAACAACGACTCTGCGTAAACAACTGCGGCTTTTATGGGAGCCAAGCAACAGAAAATCTTTGTTCCAAGTGTT
ACCGTGATCTTCATCAATCACAGCCCTTGAATCATCAGCTGCTAAACCCATCATCATCATCGGCTGCTTCTGTTTCCTCCTTTGCATCCCCAGCCGTTGA
TGTTCTAAAAGTCAACACCAACCAGAAAGCTCCTGTTGTGGTGGTGGGAGATGATAAAAAAGATGAGGTAAAGGCAGGAGAGCCTGCGGCTGGGAAGCAG
CAGCAGCAGCCAAGTAGGTGCTTGACTTGTAGGAGGCGCGTGGGGTTGACGGGGTTCAAGTGCAGGTGCGGTATGGTGTTTTGTGGAACACATAGGTACC
CGGAACAGCATGATTGCGAATTTGATTTTAAGAGTTTAGGGAAACAACAGATTGCTAAGGCTAATCCCGTTGTTAAGGGAGAGAAACTCCAAAAAATTTA
A
AA sequence
>Potri.004G184300.1 pacid=42795510 polypeptide=Potri.004G184300.1.p locus=Potri.004G184300 ID=Potri.004G184300.1.v4.1 annot-version=v4.1
MAEEQHRCQEQRLCVNNCGFYGSQATENLCSKCYRDLHQSQPLNHQLLNPSSSSAASVSSFASPAVDVLKVNTNQKAPVVVVGDDKKDEVKAGEPAAGKQ
QQQPSRCLTCRRRVGLTGFKCRCGMVFCGTHRYPEQHDCEFDFKSLGKQQIAKANPVVKGEKLQKI

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G27580 A20/AN1-like zinc finger famil... Potri.004G184300 0 1
AT5G13190 AtGILP GSH-induced LITAF domain prote... Potri.003G165900 11.31 0.6613
AT3G07870 F-box and associated interacti... Potri.002G223000 12.92 0.7426
AT2G27580 A20/AN1-like zinc finger famil... Potri.009G144100 13.85 0.7064
AT1G16180 Serinc-domain containing serin... Potri.003G186500 15.49 0.6476
AT2G40270 Protein kinase family protein ... Potri.008G072100 20.14 0.6624
AT5G21090 Leucine-rich repeat (LRR) fami... Potri.001G219500 20.73 0.6551
AT4G33430 SERK3, RKS10, E... RECEPTOR KINASES LIKE SERK 10,... Potri.001G206700 21.35 0.6432
AT3G14720 ATMPK19 ARABIDOPSIS THALIANA MAP KINAS... Potri.001G381300 22.13 0.6007 Pt-TDY1.2
AT4G33940 RING/U-box superfamily protein... Potri.004G143900 27.54 0.6022
Potri.010G060800 29.34 0.6194

Potri.004G184300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.