Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G27710 89 / 4e-24 60S acidic ribosomal protein family (.1.2.3.4) AT3G44590 86 / 4e-23 60S acidic ribosomal protein family (.1.2) AT2G27720 86 / 8e-23 60S acidic ribosomal protein family (.1.2.3) AT3G28500 79 / 3e-20 60S acidic ribosomal protein family (.1) AT5G40040 76 / 7e-19 60S acidic ribosomal protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G146200 [exp] 125 / 2e-38 AT2G27710 89 / 2e-24 60S acidic ribosomal protein family (.1.2.3.4) Potri.010G236400 [exp] 91 / 4e-25 AT2G27710 90 / 1e-24 60S acidic ribosomal protein family (.1.2.3.4)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10043377 [exp] 102 / 2e-28 AT2G27710 102 / 8e-29 60S acidic ribosomal protein family (.1.2.3.4) Lus10020575 [exp] 100 / 2e-28 AT3G44590 100 / 9e-29 60S acidic ribosomal protein family (.1.2) Lus10006270 [exp] 102 / 5e-28 AT2G27710 100 / 9e-27 60S acidic ribosomal protein family (.1.2.3.4) Lus10019533 [exp] 102 / 3e-27 AT3G44620 262 / 6e-87 protein tyrosine phosphatases;protein tyrosine phosphatases (.1.2) Lus10014070 [exp] 96 / 1e-26 AT2G27710 92 / 1e-25 60S acidic ribosomal protein family (.1.2.3.4) Lus10019846 [exp] 95 / 2e-26 AT2G27710 92 / 2e-25 60S acidic ribosomal protein family (.1.2.3.4) Lus10026714 [exp] 94 / 7e-26 AT3G44590 96 / 6e-27 60S acidic ribosomal protein family (.1.2) Lus10026712 [exp] 94 / 1e-24 AT3G44590 97 / 2e-25 60S acidic ribosomal protein family (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00428 [poplar] [flax] Ribosomal_60s 60s Acidic ribosomal protein
Representative CDS sequence Show only first row Show all	>Potri.004G185800.1 pacid=42794927 polypeptide=Potri.004G185800.1.p locus=Potri.004G185800 ID=Potri.004G185800.1.v4.1 annot-version=v4.1 ATGAAGGTTGTAGCCGCTTACTTGCTCGCCGTTCTCGGTGGCAACACCTGCCCTACCGCCGAGGACTTGAAGCACATCCTCGGATCTGTTGGAGCAGATG CTGACGATGACAGGATTGAGCTGCTGTTGTCCAGTGTGAAAGGAAAGGACATAACTGAGCTGATTGCTTCCGGAAGGGAGAAGTTGGCTTCCGTCCCTTC CGGTGGTGGCGTTGCTGTCGCCGCCGGTGGAGCTCCAGCTGCTGCTTCCGGTGGTGCTGCCCCTGCTGCCGAGGCAAAGAAAGAGGAGAAGGTTGAAGAG AAAGAGGAGTCTGATGATGATATGGGTTTCAGTCTATTCGATTAA
AA sequence Show only first row Show all	>Potri.004G185800.1 pacid=42794927 polypeptide=Potri.004G185800.1.p locus=Potri.004G185800 ID=Potri.004G185800.1.v4.1 annot-version=v4.1 MKVVAAYLLAVLGGNTCPTAEDLKHILGSVGADADDDRIELLLSSVKGKDITELIASGREKLASVPSGGGVAVAAGGAPAAASGGAAPAAEAKKEEKVEE KEESDDDMGFSLFD

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G27710			60S acidic ribosomal protein f...		Potri.004G185800 [exp]	0	1
AT2G27710			60S acidic ribosomal protein f...		Potri.009G146200 [exp]	1.41	0.9732
AT3G49010		RSU2, ATBBC1	40S RIBOSOMAL PROTEIN, breast ...		Potri.016G082300 [exp]	2.82	0.9686
AT5G02960			Ribosomal protein S12/S23 fami...		Potri.006G131500 [exp]	3.46	0.9721
AT1G15250			Zinc-binding ribosomal protein...		Potri.018G036900 [exp]	3.74	0.9689
AT3G53020		RPL24B, STV1	SHORT VALVE1, Ribosomal protei...		Potri.003G123101 [exp]	4.47	0.9710
AT2G19740			Ribosomal protein L31e family ...		Potri.001G269600 [exp]	4.69	0.9677
AT3G52590		HAP4, ERD16, UB...	HAPLESS 4, EARLY-RESPONSIVE TO...		Potri.016G077200 [exp]	5.00	0.9704	UBQ1.3
AT3G02560			Ribosomal protein S7e family p...		Potri.017G115400 [exp]	5.09	0.9731
AT4G25740			RNA binding Plectin/S10 domain...		Potri.004G073500 [exp]	6.00	0.9694
AT4G33865			Ribosomal protein S14p/S29e fa...		Potri.002G119600 [exp]	7.61	0.9495

Compare expression of checked genes

Potri.004G185800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.