Potri.004G187800 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G44860 249 / 6e-86 Ribosomal protein L24e family protein (.1.2)
AT3G53020 77 / 2e-18 RPL24B, STV1 SHORT VALVE1, Ribosomal protein L24e family protein (.1)
AT2G36620 77 / 6e-18 RPL24A ribosomal protein L24 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G148500 342 / 1e-122 AT2G44860 248 / 1e-85 Ribosomal protein L24e family protein (.1.2)
Potri.004G085300 79 / 4e-19 AT3G53020 199 / 2e-66 SHORT VALVE1, Ribosomal protein L24e family protein (.1)
Potri.012G139500 78 / 1e-18 AT3G53020 227 / 3e-77 SHORT VALVE1, Ribosomal protein L24e family protein (.1)
Potri.012G139400 78 / 1e-18 AT3G53020 227 / 3e-77 SHORT VALVE1, Ribosomal protein L24e family protein (.1)
Potri.015G141900 78 / 2e-18 AT3G53020 196 / 3e-65 SHORT VALVE1, Ribosomal protein L24e family protein (.1)
Potri.003G123101 76 / 1e-17 AT3G53020 218 / 8e-74 SHORT VALVE1, Ribosomal protein L24e family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020552 245 / 3e-84 AT2G44860 240 / 2e-82 Ribosomal protein L24e family protein (.1.2)
Lus10009403 118 / 1e-32 AT2G44860 120 / 2e-33 Ribosomal protein L24e family protein (.1.2)
Lus10008640 77 / 4e-18 AT2G36620 243 / 1e-83 ribosomal protein L24 (.1)
Lus10035584 77 / 5e-18 AT2G36620 241 / 5e-83 ribosomal protein L24 (.1)
Lus10024560 73 / 1e-16 AT2G36620 238 / 2e-81 ribosomal protein L24 (.1)
Lus10032198 73 / 1e-16 AT2G36620 240 / 1e-82 ribosomal protein L24 (.1)
Lus10006314 71 / 2e-15 AT2G36620 233 / 2e-78 ribosomal protein L24 (.1)
Lus10029583 71 / 3e-15 AT2G36620 232 / 4e-78 ribosomal protein L24 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0175 TRASH PF01246 Ribosomal_L24e Ribosomal protein L24e
Representative CDS sequence
>Potri.004G187800.1 pacid=42795869 polypeptide=Potri.004G187800.1.p locus=Potri.004G187800 ID=Potri.004G187800.1.v4.1 annot-version=v4.1
ATGAGGTTGGAGAAGTGTTGGTTCTGCTCCTCGACTGTATACCCGGGGCACGGTATCCAGTTTGTCCGCAATGATGCTAAGATTTTTCGATTTTGTAGAT
CCAAGTGCCACAAGAACTTCAAAATGAAGAGGAACCCTCGCAAAGTAAAATGGACCAAGGCCTATAGAAGGTTGCATGGGAAGGACATGACACAGGATAC
AACCTTCGAGTTTGAGAGAAAGCGAAATAGGCCTGAGAGATATGATAGGAATCTTGCTGAGAATACTTTGAAGGCTATTAAGAAGATTGATAAGGTCAGA
TCCGACCGGGCAGCAAGCCACATAGAGAAGAGGTTGAAGGTCAGGAAAGGCAAGGAGCGGAGAGAGGCACAAAAGGAATTGGAGCAGTCGATTCACTTGG
TCAAGGCTCCTCAAGTGCTTCGACAAGACCAATCTCTCACGTTACCCAAGATCAAAGTCGAGGTTTCTCAACCAAAAAGCGAGAAAAATCAGGCAATGGA
AGAGTGA
AA sequence
>Potri.004G187800.1 pacid=42795869 polypeptide=Potri.004G187800.1.p locus=Potri.004G187800 ID=Potri.004G187800.1.v4.1 annot-version=v4.1
MRLEKCWFCSSTVYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHGKDMTQDTTFEFERKRNRPERYDRNLAENTLKAIKKIDKVR
SDRAASHIEKRLKVRKGKERREAQKELEQSIHLVKAPQVLRQDQSLTLPKIKVEVSQPKSEKNQAMEE

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G44860 Ribosomal protein L24e family ... Potri.004G187800 0 1
AT3G49010 RSU2, ATBBC1 40S RIBOSOMAL PROTEIN, breast ... Potri.001G131000 8.42 0.8575 ATBBC1.2
AT2G39840 TOPP4 type one serine/threonine prot... Potri.008G060800 13.26 0.8217 Pt-TOPP4.2
AT1G60770 Tetratricopeptide repeat (TPR)... Potri.006G157400 13.56 0.8004
AT4G36130 Ribosomal protein L2 family (.... Potri.007G013101 14.83 0.8426
AT4G33865 Ribosomal protein S14p/S29e fa... Potri.009G090000 15.29 0.8367
AT5G27700 Ribosomal protein S21e (.1) Potri.013G017600 16.43 0.8568
AT5G37350 Serine/threonine-protein kinas... Potri.015G096100 16.73 0.7583
AT1G26880 Ribosomal protein L34e superfa... Potri.017G082200 16.97 0.8424 Pt-RPL34.5
AT1G30580 GTP binding (.1) Potri.001G465900 18.16 0.7827
AT3G53740 Ribosomal protein L36e family ... Potri.012G142600 18.43 0.8449

Potri.004G187800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.