Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	PSK6.2
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G44735 69 / 1e-16 PSK1, ATPSK3 PHYTOSULFOKINE 3 PRECURSOR (.1.2) AT5G65870 41 / 5e-06 ATPSK5 phytosulfokine 5 precursor (.1) AT3G49780 40 / 1e-05 ATPSK3(FORMERSYMBOL), ATPSK3(FORMERSYMBOL), ATPSK4, ATPSK3(FORMERSYMBOL), ATPSK3(FORMERSYMBOL), ATP phytosulfokine 4 precursor (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G148900 [exp] 103 / 2e-30 AT3G44735 65 / 2e-15 PHYTOSULFOKINE 3 PRECURSOR (.1.2) Potri.007G006800 [exp] 44 / 5e-07 AT3G49780 60 / 1e-13 phytosulfokine 4 precursor (.1) Potri.002G116300 [exp] 41 / 4e-06 AT2G22860 50 / 5e-10 phytosulfokine 2 precursor (.1) Potri.009G085600 [exp] 41 / 6e-06 AT3G49780 68 / 1e-16 phytosulfokine 4 precursor (.1) Potri.014G006900 [exp] 39 / 6e-05 AT2G22860 52 / 2e-10 phytosulfokine 2 precursor (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020548 [exp] 54 / 5e-11 AT3G44735 55 / 8e-12 PHYTOSULFOKINE 3 PRECURSOR (.1.2) Lus10027716 [exp] 49 / 8e-09 AT3G44735 57 / 4e-12 PHYTOSULFOKINE 3 PRECURSOR (.1.2) Lus10035572 [exp] 42 / 2e-06 AT3G44735 54 / 4e-11 PHYTOSULFOKINE 3 PRECURSOR (.1.2) Lus10030572 [exp] 40 / 2e-05 AT1G13590 51 / 7e-10 phytosulfokine 1 precursor (.1) Lus10030916 [exp] 39 / 3e-05 AT1G13590 56 / 8e-12 phytosulfokine 1 precursor (.1) Lus10011721 [exp] 39 / 0.0002 AT3G49780 53 / 3e-10 phytosulfokine 4 precursor (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF06404 [poplar] [flax] PSK Phytosulfokine precursor protein (PSK)
Representative CDS sequence Show only first row Show all	>Potri.004G188200.1 pacid=42796352 polypeptide=Potri.004G188200.1.p locus=Potri.004G188200 ID=Potri.004G188200.1.v4.1 annot-version=v4.1 ATGAAGCAAACCCTTCATTACAAAGCTCTTCTCCTCTTCCTTCTTGTCCTTGTTCATTCCTCAAAATTATCTGCGCGTTTCCTATTAAGCAAACAAGGGA AAGAGGATTTGAACCTGAAAGAAATCACCAGCGAAGGGACTTTTGCGCAAACGGAGGACAGTGAATTGATAACGAATCAGCTAATGGGGTTAGAGGTGTG TCGTGGTGGAGACGAGGAATGTTTCAAGAGAAGGATAATTGCAGAGGCTCACTTGGACTATATCTACACCCAGCATCACAAGCCCTGA
AA sequence Show only first row Show all	>Potri.004G188200.1 pacid=42796352 polypeptide=Potri.004G188200.1.p locus=Potri.004G188200 ID=Potri.004G188200.1.v4.1 annot-version=v4.1 MKQTLHYKALLLFLLVLVHSSKLSARFLLSKQGKEDLNLKEITSEGTFAQTEDSELITNQLMGLEVCRGGDEECFKRRIIAEAHLDYIYTQHHKP

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G44735		PSK1, ATPSK3	PHYTOSULFOKINE 3 PRECURSOR (.1...		Potri.004G188200 [exp]	0	1	PSK6.2
AT1G04280			P-loop containing nucleoside t...		Potri.008G162000 [exp]	4.24	0.8965
					Potri.006G256900 [exp]	10.19	0.8876
AT5G10970	C2H2ZnF		C2H2 and C2HC zinc fingers sup...		Potri.018G021400 [exp]	12.96	0.9034
AT3G14470			NB-ARC domain-containing disea...		Potri.017G143820 [exp]	13.49	0.8868
AT5G08240			unknown protein		Potri.005G092400 [exp]	15.09	0.8836
AT3G22060			Receptor-like protein kinase-r...		Potri.017G040300 [exp]	16.79	0.8651
AT3G14470			NB-ARC domain-containing disea...		Potri.017G143700 [exp]	17.88	0.8993
AT2G16760			Calcium-dependent phosphotries...		Potri.014G120300 [exp]	18.54	0.8438
AT3G50700	C2H2ZnF	ATIDD2	indeterminate(ID)-domain 2 (.1...		Potri.002G208444 [exp]	19.18	0.8929
AT5G50710			unknown protein		Potri.012G101800 [exp]	21.44	0.8819

Compare expression of checked genes

Potri.004G188200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.