Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G27140 81 / 1e-19 HSP20-like chaperones superfamily protein (.1) AT5G20970 79 / 1e-18 HSP20-like chaperones superfamily protein (.1) AT5G04890 64 / 1e-12 RTM2 RESTRICTED TEV MOVEMENT 2, HSP20-like chaperones superfamily protein (.1) AT1G54400 60 / 6e-12 HSP20-like chaperones superfamily protein (.1) AT3G10680 46 / 2e-06 HSP20-like chaperones superfamily protein (.1) AT1G07400 38 / 0.0006 HSP20-like chaperones superfamily protein (.1) AT1G59860 37 / 0.001 HSP20-like chaperones superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G153000 [exp] 212 / 1e-70 AT2G27140 79 / 1e-17 HSP20-like chaperones superfamily protein (.1) Potri.009G153100 [exp] 154 / 1e-47 AT2G27140 110 / 5e-29 HSP20-like chaperones superfamily protein (.1) Potri.009G153200 [exp] 95 / 6e-25 AT2G27140 89 / 9e-22 HSP20-like chaperones superfamily protein (.1) Potri.004G191101 [exp] 94 / 1e-23 AT2G27140 109 / 2e-28 HSP20-like chaperones superfamily protein (.1) Potri.004G191200 [exp] 92 / 5e-23 AT2G27140 106 / 3e-27 HSP20-like chaperones superfamily protein (.1) Potri.013G054900 [exp] 77 / 2e-18 AT1G54400 97 / 3e-25 HSP20-like chaperones superfamily protein (.1) Potri.008G013800 [exp] 76 / 8e-17 AT5G04890 135 / 3e-36 RESTRICTED TEV MOVEMENT 2, HSP20-like chaperones superfamily protein (.1) Potri.010G245500 [exp] 66 / 1e-13 AT5G04890 113 / 2e-28 RESTRICTED TEV MOVEMENT 2, HSP20-like chaperones superfamily protein (.1) Potri.013G054800 [exp] 61 / 3e-12 AT1G54400 98 / 6e-26 HSP20-like chaperones superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008426 [exp] 96 / 4e-24 AT2G27140 111 / 7e-29 HSP20-like chaperones superfamily protein (.1) Lus10003356 [exp] 80 / 9e-19 AT2G27140 103 / 3e-26 HSP20-like chaperones superfamily protein (.1) Lus10032902 [exp] 63 / 1e-12 AT1G54400 89 / 4e-22 HSP20-like chaperones superfamily protein (.1) Lus10024258 [exp] 62 / 1e-12 AT5G04890 61 / 2e-11 RESTRICTED TEV MOVEMENT 2, HSP20-like chaperones superfamily protein (.1) Lus10028874 [exp] 55 / 2e-09 AT5G04890 103 / 4e-24 RESTRICTED TEV MOVEMENT 2, HSP20-like chaperones superfamily protein (.1) Lus10008946 [exp] 49 / 3e-07 AT5G04890 102 / 3e-24 RESTRICTED TEV MOVEMENT 2, HSP20-like chaperones superfamily protein (.1) Lus10023624 [exp] 47 / 1e-06 AT5G04890 47 / 4e-06 RESTRICTED TEV MOVEMENT 2, HSP20-like chaperones superfamily protein (.1) Lus10020815 [exp] 45 / 2e-06 AT5G37670 166 / 6e-54 HSP20-like chaperones superfamily protein (.1) Lus10004039 [exp] 44 / 2e-06 AT5G37670 150 / 3e-48 HSP20-like chaperones superfamily protein (.1) Lus10033409 [exp] 40 / 0.0003 AT3G10680 52 / 2e-07 HSP20-like chaperones superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0190 [poplar] [flax] HSP20 PF00011 [poplar] [flax] HSP20 Hsp20/alpha crystallin family
Representative CDS sequence Show only first row Show all	>Potri.004G191000.3 pacid=42793904 polypeptide=Potri.004G191000.3.p locus=Potri.004G191000 ID=Potri.004G191000.3.v4.1 annot-version=v4.1 ATGGATAGCACTAGGCCATTGGCTAAAGTTAATGATCAAGTCTATGAAGATATTGATCCTAAAATGGAATGGGTGAATGATGCTGGATTCGACACCCTAC TTGTCCGTCTACCAGGTTTTACGAAGCAGCAACTAAGGATCCAAGCAGCAACAGGTGATCGAAAACTCAAGATCACAGGAAAGAGCCGTCAGAGAAACAA TAAATTGATCCGTTTTAACAAGGAGCTTACTGTTCCATCAGATTATAATCTTGATCAAATCCGTGCTAAGTTTGAGGGTGGAGTACTTTATATCAAACAC CCCAAGAAGAATATCAGTCCAGCCATGCCAGTACAGGAAAATAATGCAAGCTCAACTGCAGAGCCTCAAAAGCCTGCAAATGAAAAACCAGAAGACGGAA CGAGTGGACAAGATTAG
AA sequence Show only first row Show all	>Potri.004G191000.3 pacid=42793904 polypeptide=Potri.004G191000.3.p locus=Potri.004G191000 ID=Potri.004G191000.3.v4.1 annot-version=v4.1 MDSTRPLAKVNDQVYEDIDPKMEWVNDAGFDTLLVRLPGFTKQQLRIQAATGDRKLKITGKSRQRNNKLIRFNKELTVPSDYNLDQIRAKFEGGVLYIKH PKKNISPAMPVQENNASSTAEPQKPANEKPEDGTSGQD

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G27140			HSP20-like chaperones superfam...		Potri.004G191000 [exp]	0	1
					Potri.005G084651 [exp]	3.00	0.9813
AT5G55810		ATNMNAT	nicotinate/nicotinamide mononu...		Potri.013G021900 [exp]	3.74	0.9590
AT5G40660			ATP12 protein-related (.1)		Potri.001G338200 [exp]	5.56	0.9251
AT4G05120		FUR1, ENT3, FLU...	FUDR RESISTANT 1, EQUILIBRATIV...		Potri.019G118400 [exp]	8.00	0.9571
AT4G34090			unknown protein		Potri.007G045900 [exp]	9.38	0.9664
					Potri.006G273732 [exp]	10.19	0.9596
					Potri.001G177201 [exp]	13.85	0.9243
AT3G05327			Cyclin family protein (.1)		Potri.005G033600 [exp]	14.28	0.9473
AT3G52090		NRPE11, NRPD11,...	DNA-directed RNA polymerase, R...		Potri.009G070900 [exp]	15.93	0.8481	RPB13.1
					Potri.001G174000 [exp]	16.30	0.9454

Compare expression of checked genes

Potri.004G191000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.