Potri.004G191700 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G55710 228 / 2e-76 AtTic20-V translocon at the inner envelope membrane of chloroplasts 20-V, unknown protein
AT2G47840 112 / 1e-30 AtTic20-II translocon at the inner envelope membrane of chloroplasts 20-II, Uncharacterised conserved protein ycf60 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G084900 97 / 5e-25 AT2G47840 196 / 2e-63 translocon at the inner envelope membrane of chloroplasts 20-II, Uncharacterised conserved protein ycf60 (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10031203 246 / 2e-83 AT5G55710 263 / 3e-90 translocon at the inner envelope membrane of chloroplasts 20-V, unknown protein
Lus10031781 244 / 1e-82 AT5G55710 267 / 1e-91 translocon at the inner envelope membrane of chloroplasts 20-V, unknown protein
Lus10020219 99 / 1e-25 AT2G47840 222 / 1e-73 translocon at the inner envelope membrane of chloroplasts 20-II, Uncharacterised conserved protein ycf60 (.1)
Lus10026842 97 / 7e-25 AT2G47840 219 / 1e-72 translocon at the inner envelope membrane of chloroplasts 20-II, Uncharacterised conserved protein ycf60 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF16166 TIC20 Chloroplast import apparatus Tic20-like
Representative CDS sequence
>Potri.004G191700.1 pacid=42796002 polypeptide=Potri.004G191700.1.p locus=Potri.004G191700 ID=Potri.004G191700.1.v4.1 annot-version=v4.1
ATGTCCACTCTTCTCTTTCCACAAGCCCCTCTTACCCTCTCCCAAAAACCCTTCCTTCTCTCCCTCAGAAACCCATCTTTTTTGCCTCACGCAAGAAAAT
GGAAAGGGCCCAGAAGACTAATTTTAGCCAAATCCAACGGTAACGATTCAGTAGACACAACAGACAGGATAATCTCTGCCGTCTGTTACTTCTACCCATT
CTTTGACGGGATCCAGTACGGAAAATACGTCATAACCCAGTTTTCTCCAATTCAAGCTCTCATCCAGCCTCTGTTCCCAGCTATAAAAGTCTTTAAGAGC
TTTCCCTTAAATGGGTTTTTGGTGTTTTTGACTCTTTACTTTGTTGTTGTGAGAAACTCCAATTTTAGCAGATATGTGAGGTTCAATACCATGCAAGCTA
TAGTGCTTGATGTGTTGTTGATATTTCCTGATTTGTTAGAGAGGAGTTTTAATCCAAGAGATGGGTTGGGATTGGATTTGTTGATGAGTTTGGACAGTAC
TGTGTTTTTGTACCTTTTGGTTTGTTTGATTTATGGGTCTACTTCTTGTTTGTTTGGTCAGATTCCTAGGTTGCCCATTGTTGCTGAGGCTGCTGATAGG
CAGGTTCTTTAG
AA sequence
>Potri.004G191700.1 pacid=42796002 polypeptide=Potri.004G191700.1.p locus=Potri.004G191700 ID=Potri.004G191700.1.v4.1 annot-version=v4.1
MSTLLFPQAPLTLSQKPFLLSLRNPSFLPHARKWKGPRRLILAKSNGNDSVDTTDRIISAVCYFYPFFDGIQYGKYVITQFSPIQALIQPLFPAIKVFKS
FPLNGFLVFLTLYFVVVRNSNFSRYVRFNTMQAIVLDVLLIFPDLLERSFNPRDGLGLDLLMSLDSTVFLYLLVCLIYGSTSCLFGQIPRLPIVAEAADR
QVL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G55710 AtTic20-V translocon at the inner envelo... Potri.004G191700 0 1
AT2G27290 Protein of unknown function (D... Potri.009G161800 2.00 0.9707
AT3G20930 RNA-binding (RRM/RBD/RNP motif... Potri.010G237200 3.31 0.9716
AT5G10600 CYP81K2 "cytochrome P450, family 81, s... Potri.014G021400 6.63 0.9519 Pt-IFS1.54
AT1G06430 FTSH8 FTSH protease 8 (.1) Potri.002G220366 6.92 0.9607
Potri.005G164800 7.14 0.9532
AT2G41950 unknown protein Potri.006G194600 11.48 0.9594
AT3G46610 Pentatricopeptide repeat (PPR-... Potri.017G070800 11.87 0.9630
AT2G30950 FTSH2, VAR2 VARIEGATED 2, FtsH extracellul... Potri.002G215100 11.95 0.9558
AT3G10670 ABCI6, ATNAP7 ATP-binding cassette I6, non-i... Potri.008G012500 12.44 0.9594 NAP7.2
AT5G42270 FTSH5, VAR1 VARIEGATED 1, FtsH extracellul... Potri.002G012000 13.41 0.9586 FTSH2.2

Potri.004G191700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.