Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G52590 209 / 4e-71 HAP4, ERD16, UBQ1, EMB2167 HAPLESS 4, EARLY-RESPONSIVE TO DEHYDRATION 16, EMBRYO DEFECTIVE 2167, ubiquitin extension protein 1 (.1) AT2G36170 209 / 4e-71 Ubiquitin supergroup;Ribosomal protein L40e (.1) AT4G05050 144 / 4e-45 UBQ11 ubiquitin 11 (.1.2.3.4) AT2G35635 144 / 4e-45 UBQ7, RUB2 RELATED TO UBIQUITIN 2, ubiquitin 7 (.1) AT1G31340 144 / 5e-45 NEDD8, ATRUB1, RUB1 ARABIDOPSIS THALIANA RELATED TO UBIQUITIN 1, related to ubiquitin 1 (.1) AT1G23410 143 / 1e-44 Ribosomal protein S27a / Ubiquitin family protein (.1) AT2G47110 143 / 1e-44 UBQ6 ubiquitin 6 (.1.2) AT3G62250 143 / 1e-44 UBQ5 ubiquitin 5 (.1) AT4G02890 145 / 2e-44 UBQ14 Ubiquitin family protein (.1.2.3.4) AT1G55060 143 / 9e-44 UBQ12 ubiquitin 12 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G077200 [exp] 210 / 2e-71 AT3G52590 260 / 2e-91 HAPLESS 4, EARLY-RESPONSIVE TO DEHYDRATION 16, EMBRYO DEFECTIVE 2167, ubiquitin extension protein 1 (.1) Potri.012G024300 [exp] 210 / 2e-71 AT3G52590 260 / 2e-91 HAPLESS 4, EARLY-RESPONSIVE TO DEHYDRATION 16, EMBRYO DEFECTIVE 2167, ubiquitin extension protein 1 (.1) Potri.015G007100 [exp] 210 / 2e-71 AT3G52590 260 / 2e-91 HAPLESS 4, EARLY-RESPONSIVE TO DEHYDRATION 16, EMBRYO DEFECTIVE 2167, ubiquitin extension protein 1 (.1) Potri.016G077000 [exp] 164 / 2e-53 AT3G52590 194 / 1e-65 HAPLESS 4, EARLY-RESPONSIVE TO DEHYDRATION 16, EMBRYO DEFECTIVE 2167, ubiquitin extension protein 1 (.1) Potri.002G062500 [exp] 144 / 6e-45 AT1G31340 296 / 9e-105 ARABIDOPSIS THALIANA RELATED TO UBIQUITIN 1, related to ubiquitin 1 (.1) Potri.014G115100 [exp] 144 / 1e-44 AT2G47110 255 / 2e-88 ubiquitin 6 (.1.2) Potri.015G111500 [exp] 144 / 1e-44 AT2G47110 257 / 3e-89 ubiquitin 6 (.1.2) Potri.002G190000 [exp] 144 / 1e-44 AT2G47110 257 / 3e-89 ubiquitin 6 (.1.2) Potri.012G114000 [exp] 144 / 1e-44 AT2G47110 257 / 3e-89 ubiquitin 6 (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008873 [exp] 210 / 3e-71 AT3G52590 261 / 5e-92 HAPLESS 4, EARLY-RESPONSIVE TO DEHYDRATION 16, EMBRYO DEFECTIVE 2167, ubiquitin extension protein 1 (.1) Lus10030894 [exp] 143 / 1e-44 AT2G47110 257 / 3e-89 ubiquitin 6 (.1.2) Lus10030595 [exp] 143 / 1e-44 AT2G47110 257 / 3e-89 ubiquitin 6 (.1.2) Lus10018367 [exp] 145 / 3e-44 AT4G05320 452 / 4e-164 polyubiquitin 10 (.1.2.3.4.5.6) Lus10022695 [exp] 86 / 1e-22 AT2G36170 120 / 3e-37 Ubiquitin supergroup;Ribosomal protein L40e (.1) Lus10023236 [exp] 60 / 1e-12 AT3G52590 84 / 1e-22 HAPLESS 4, EARLY-RESPONSIVE TO DEHYDRATION 16, EMBRYO DEFECTIVE 2167, ubiquitin extension protein 1 (.1) Lus10010493 [exp] 58 / 2e-10 AT4G12570 830 / 0.0 ubiquitin protein ligase 5 (.1) Lus10034563 [exp] 55 / 2e-09 AT5G42220 444 / 3e-148 Ubiquitin-like superfamily protein (.1) Lus10008806 [exp] 54 / 7e-09 AT5G23740 282 / 1e-89 ribosomal protein S11-beta (.1) Lus10040001 [exp] 54 / 7e-09 AT5G25270 328 / 3e-102 Ubiquitin-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0167 [poplar] [flax] Zn_Beta_Ribbon PF01020 [poplar] [flax] Ribosomal_L40e Ribosomal L40e family CL0072 [poplar] [flax] Ubiquitin PF11976 [poplar] [flax] Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Representative CDS sequence Show only first row Show all	>Potri.004G194000.3 pacid=42796353 polypeptide=Potri.004G194000.3.p locus=Potri.004G194000 ID=Potri.004G194000.3.v4.1 annot-version=v4.1 ATGCAGATATTTGTGAAAACCCTAACTGGGAAGACTATTACTCTCGAGGTTGAGAGTAGTTACACAGTTGACAATGTCAAGGCCAAAATCCAAGACAAGG AAGGAATTCCGCCGGAACAACAGAGGTTGATTTTTGCTGGAAAGCAACTTGAAGATAGCCGTACCTTAGCTAGTTACGATATCCAGAAAGAATCCACACT TCATCTAGTCTTGAGGCTTAGGGGAGGAAAAGGAGCTCCTAGCATGAAAATTGAGCCCTCCCTGAGGGAACTAGCTCGTAAATTCAATCAATACAAGCTG ATTTGCCGCAGCTTAGTACTGTTTTGGCTTGCTAGATGTTATTCTCGTCTGCCTCCCAGAGCTAAGAACTGCAGGAAGAAGAAGTGTGGCCATAGCAATG AGCTGAGGCCTAAGAAGTTACCCCAGGGCTAA
AA sequence Show only first row Show all	>Potri.004G194000.3 pacid=42796353 polypeptide=Potri.004G194000.3.p locus=Potri.004G194000 ID=Potri.004G194000.3.v4.1 annot-version=v4.1 MQIFVKTLTGKTITLEVESSYTVDNVKAKIQDKEGIPPEQQRLIFAGKQLEDSRTLASYDIQKESTLHLVLRLRGGKGAPSMKIEPSLRELARKFNQYKL ICRSLVLFWLARCYSRLPPRAKNCRKKKCGHSNELRPKKLPQG

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G52590		HAP4, ERD16, UB...	HAPLESS 4, EARLY-RESPONSIVE TO...		Potri.004G194000 [exp]	0	1
AT5G24590	NAC	TIP, ANAC091	Arabidopsis NAC domain contain...		Potri.019G099800 [exp]	4.89	0.8816
					Potri.002G252050 [exp]	6.08	0.9143
AT5G40690			unknown protein		Potri.001G338100 [exp]	12.24	0.7824
					Potri.019G073801 [exp]	16.09	0.9143
					Potri.014G003683 [exp]	18.24	0.9143
					Potri.001G004900 [exp]	20.00	0.9100
					Potri.018G090350 [exp]	20.44	0.9088
AT5G24040			Protein of unknown function (D...		Potri.009G078900 [exp]	22.36	0.6973
AT1G53440			Leucine-rich repeat transmembr...		Potri.016G011400 [exp]	24.81	0.8979
AT4G13440			Calcium-binding EF-hand family...		Potri.019G026820 [exp]	24.97	0.8986

Compare expression of checked genes

Potri.004G194000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.