Plant FIBer expression Database

Potri.004G194250 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10003365
[exp]
51 / 1e-08 AT3G03740 601 / 0.0 BTB-POZ and MATH domain 4 (.1)
Lus10008421
[exp]
46 / 5e-07 AT3G03740 599 / 0.0 BTB-POZ and MATH domain 4 (.1)
PFAM info
Representative CDS sequence
>Potri.004G194250.2 pacid=42794722 polypeptide=Potri.004G194250.2.p locus=Potri.004G194250 ID=Potri.004G194250.2.v4.1 annot-version=v4.1
ATGTCCACAATGCTTTGGTGCACTCACTGTGCCATAAAGTGCCAGACCTTACGCGAAGGAGATTTCTTGTCATGCTCTATGTGTGGTAAGGTTCTTAGCA
TGTTGACTTGGCACAAAAAGCTCAATATAAGAAATCCTAGATCTAAAAGAACCAAGAGAAGGAGGAATAATGTACAAGTAGCTGATGATGAATCCTCTGT
AAATGTTGATGATGGTTTATTAGACACTGCTAAAAGGCCAAGTGTTAAAGTGAATAAAGATAGTGTGGGGGTAAATTAG
AA sequence
>Potri.004G194250.2 pacid=42794722 polypeptide=Potri.004G194250.2.p locus=Potri.004G194250 ID=Potri.004G194250.2.v4.1 annot-version=v4.1
MSTMLWCTHCAIKCQTLREGDFLSCSMCGKVLSMLTWHKKLNIRNPRSKRTKRRRNNVQVADDESSVNVDDGLLDTAKRPSVKVNKDSVGVN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.004G194250
[exp]
0 1
AT1G23420 YABBY INO, YAB4 INNER NO OUTER, Plant-specific... Potri.008G189000
[exp]
1.73 0.9903
Potri.005G149001
[exp]
2.44 0.9903
Potri.015G030750
[exp]
3.16 0.9421
AT5G13200 GRAM domain family protein (.1... Potri.003G165400
[exp]
3.74 0.9542
AT3G12410 Polynucleotidyl transferase, r... Potri.002G185500
[exp]
4.24 0.9458
AT1G52360 Coatomer, beta' subunit (.1.2) Potri.006G250200
[exp]
4.47 0.9773
AT5G10625 unknown protein Potri.006G276100
[exp]
5.47 0.9685
AT2G02240 MEE66 maternal effect embryo arrest ... Potri.006G267000
[exp]
7.74 0.8665
Potri.005G170132
[exp]
8.66 0.6817
AT3G55620 eIF6A, EMB1624 embryo defective 1624, eukaryo... Potri.005G098700
[exp]
9.48 0.8541

Potri.004G194250 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.