Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G43720 94 / 6e-24 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT2G27130 89 / 4e-22 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G13820 67 / 8e-14 AtXYP2 xylogen protein 2, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT5G64080 64 / 1e-12 AtXYP1 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) AT4G08670 59 / 1e-10 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT3G22600 56 / 1e-09 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G36150 55 / 7e-09 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT1G03103 52 / 2e-08 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G48130 52 / 4e-08 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G14815 49 / 3e-07 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G158100 [exp] 163 / 1e-50 AT3G43720 106 / 5e-29 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.003G020200 [exp] 57 / 3e-10 AT5G64080 121 / 5e-35 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.010G085400 [exp] 57 / 5e-10 AT3G22600 140 / 1e-42 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G210100 [exp] 57 / 5e-10 AT5G64080 118 / 7e-34 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.008G155100 [exp] 55 / 3e-09 AT3G22600 149 / 2e-46 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.002G050400 [exp] 51 / 8e-08 AT3G22600 100 / 1e-26 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.005G212000 [exp] 48 / 9e-07 AT2G48140 113 / 4e-32 embryo sac development arrest 4, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.005G169000 [exp] 48 / 1e-06 AT5G64080 86 / 7e-21 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.008G155200 [exp] 47 / 2e-06 AT2G48140 121 / 2e-34 embryo sac development arrest 4, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001153 [exp] 101 / 1e-26 AT3G43720 105 / 1e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10026769 [exp] 86 / 2e-20 AT3G43720 93 / 1e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10026768 [exp] 82 / 8e-20 AT2G27130 81 / 4e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10008401 [exp] 84 / 1e-19 AT3G43720 91 / 1e-22 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10008400 [exp] 79 / 1e-18 AT3G43720 76 / 6e-18 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10010572 [exp] 66 / 2e-13 AT3G22600 162 / 2e-51 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10039348 [exp] 66 / 3e-13 AT3G22600 163 / 7e-52 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10014681 [exp] 65 / 6e-13 AT3G22600 126 / 3e-37 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10021604 [exp] 64 / 2e-12 AT5G64080 142 / 4e-43 xylogen protein 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10041197 [exp] 63 / 4e-12 AT3G22600 117 / 9e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [poplar] [flax] Prolamin PF14368 [poplar] [flax] LTP_2 Probable lipid transfer
Representative CDS sequence Show only first row Show all	>Potri.004G196000.1 pacid=42795310 polypeptide=Potri.004G196000.1.p locus=Potri.004G196000 ID=Potri.004G196000.1.v4.1 annot-version=v4.1 ATGTCGAAACTAGGCATCACCACCATAATTCTGACCCTAGCCCTCATTTCAACAGTGCCAGCAAACACGGCAGCAGCCCCAGCCCCGGCCCCGGCGGAAG CACCTGCACCTGTTTCAGGTCTTGGTCCGGCCGCCCCGGCTCCCGTGGAAGCACCTGCACCCGTTTCAGATTTTGGTCCGGCAGCTTATGGACCAATCCC TGGTAATGATTGTATAACAGCAGTGGCGAATGCGTCTGATTGCTTGGACTATGTAACAACAGGAAGTAACTTGACCGTTCCTGACAAGAATTGCTGTCCT GAGATTGCTGGGTTGATAGAGACCAATGTTATATGTTTGTGTCAGTTGCTTAGTGGTGATGTTGCTAAGCAATTTGGGCTCTCAATTGATTTCGGTAGAG CTGTTAACCTTCCTGCAGTTTGCAAGATTGCTAATGTTCCTTCAGCCTCCTTGTGCTCAGTTGCGGGATTCCCAGTAGCTGCTCCTGCAAGCGGTCCATC AACAGGCTTACCACCTCCAGTCCCAGCTGCTGAGTCCCCGGGAGGATTAGCGGCAGGCCCATCAGCTGGAGAAAAGGGCGCTGCTTCAAGCATTGCAGGC TCAGCTTTTGCCGTCTTTGGTGGCTTAGCAATTTCAATTCTTTCAACATTGTTCTGA
AA sequence Show only first row Show all	>Potri.004G196000.1 pacid=42795310 polypeptide=Potri.004G196000.1.p locus=Potri.004G196000 ID=Potri.004G196000.1.v4.1 annot-version=v4.1 MSKLGITTIILTLALISTVPANTAAAPAPAPAEAPAPVSGLGPAAPAPVEAPAPVSDFGPAAYGPIPGNDCITAVANASDCLDYVTTGSNLTVPDKNCCP EIAGLIETNVICLCQLLSGDVAKQFGLSIDFGRAVNLPAVCKIANVPSASLCSVAGFPVAAPASGPSTGLPPPVPAAESPGGLAAGPSAGEKGAASSIAG SAFAVFGGLAISILSTLF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G43720			Bifunctional inhibitor/lipid-t...		Potri.004G196000 [exp]	0	1
AT4G38840			SAUR-like auxin-responsive pro...		Potri.004G164800 [exp]	7.41	0.9921
AT2G45180			Bifunctional inhibitor/lipid-t...		Potri.006G256100 [exp]	12.84	0.9919
AT2G20870			cell wall protein precursor, p...		Potri.013G144200 [exp]	14.28	0.9918
AT5G20270		HHP1	heptahelical transmembrane pro...		Potri.006G064400 [exp]	15.81	0.9165
AT5G20630		ATGER3, GLP3A, ...	GERMIN-LIKE PROTEIN 3, ARABIDO...		Potri.006G142600 [exp]	16.88	0.9914
AT3G60470			Plant protein of unknown funct...		Potri.005G008350 [exp]	16.97	0.9579
AT1G27940		ABCB13, PGP13	ATP-binding cassette B13, P-gl...		Potri.002G019600 [exp]	17.60	0.9910
AT5G33370			GDSL-like Lipase/Acylhydrolase...		Potri.019G024600 [exp]	18.97	0.9913
					Potri.017G047500 [exp]	19.97	0.9912
AT3G24420			alpha/beta-Hydrolases superfam...		Potri.016G062700 [exp]	21.72	0.9911

Compare expression of checked genes

Potri.004G196000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.