Potri.004G202466 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G106800 108 / 3e-32 AT3G57770 56 / 8e-11 Protein kinase superfamily protein (.1)
Potri.005G107066 108 / 3e-32 AT1G16820 52 / 3e-10 vacuolar ATP synthase catalytic subunit-related / V-ATPase-related / vacuolar proton pump-related (.1.2)
Potri.005G106933 105 / 8e-31 AT1G16820 52 / 2e-10 vacuolar ATP synthase catalytic subunit-related / V-ATPase-related / vacuolar proton pump-related (.1.2)
Potri.005G106600 104 / 1e-30 AT3G57770 56 / 9e-11 Protein kinase superfamily protein (.1)
Potri.007G002300 64 / 9e-15 ND /
Potri.008G047850 58 / 2e-12 AT3G57770 59 / 5e-12 Protein kinase superfamily protein (.1)
Potri.003G175366 48 / 1e-08 AT1G16820 57 / 2e-12 vacuolar ATP synthase catalytic subunit-related / V-ATPase-related / vacuolar proton pump-related (.1.2)
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.004G202466.1 pacid=42794362 polypeptide=Potri.004G202466.1.p locus=Potri.004G202466 ID=Potri.004G202466.1.v4.1 annot-version=v4.1
GAGAAGCGCGACACGTTAACAAGCATACCTTTCTCGGCCTTTTGGCTAAGATCAAGTGTAGTATCTGTTCTTATCAGTTTAATATCTGATACGTGGGCCA
ATGGCTCACACGATATTAAATTAATATTTTTAGGGGGAGGGTCCGTAACAATAGCTTGCTATTGGGGTTCTCGAGCGTCGCCTGCGCGTTGCACTAAAGC
ATTGGCCTGGCGCACCCCACCAATACTAGTTGAATTGATTTCTCATAGTCTGATAGTTATATATATATATATACACTGTCAAGAACTAAATTTATTGGAA
TTTAGCTTGAATAGCTTTAATAAAGATATGCGATGGTCTTAA
AA sequence
>Potri.004G202466.1 pacid=42794362 polypeptide=Potri.004G202466.1.p locus=Potri.004G202466 ID=Potri.004G202466.1.v4.1 annot-version=v4.1
EKRDTLTSIPFSAFWLRSSVVSVLISLISDTWANGSHDIKLIFLGGGSVTIACYWGSRASPARCTKALAWRTPPILVELISHSLIVIYIYIHCQELNLLE
FSLNSFNKDMRWS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G16820 vacuolar ATP synthase catalyti... Potri.004G202466 0 1
AT1G16820 vacuolar ATP synthase catalyti... Potri.003G175366 14.59 0.8667
Potri.008G223900 21.81 0.8452
Potri.008G225001 26.83 0.8380
Potri.018G115200 30.46 0.8293
Potri.008G224138 35.07 0.8273
Potri.008G224400 39.19 0.8248
Potri.008G224282 40.95 0.8244
Potri.008G224165 42.49 0.8208
Potri.002G263451 44.21 0.7963
Potri.014G186380 46.13 0.8192

Potri.004G202466 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.