Plant FIBer expression Database

Potri.004G202766 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G08360 336 / 1e-118 Ribosomal protein L1p/L10e family (.1)
AT2G27530 335 / 3e-118 PGY1 PIGGYBACK1, Ribosomal protein L1p/L10e family (.1.2)
AT5G22440 329 / 8e-116 Ribosomal protein L1p/L10e family (.1.2)
AT1G06380 42 / 0.0001 Ribosomal protein L1p/L10e family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G035600
[exp]
397 / 1e-142 AT2G27530 339 / 9e-120 PIGGYBACK1, Ribosomal protein L1p/L10e family (.1.2)
Potri.004G202832
[exp]
394 / 9e-142 AT2G27530 337 / 7e-119 PIGGYBACK1, Ribosomal protein L1p/L10e family (.1.2)
Potri.007G034800
[exp]
391 / 1e-140 AT2G27530 338 / 2e-119 PIGGYBACK1, Ribosomal protein L1p/L10e family (.1.2)
Potri.015G147700
[exp]
54 / 3e-08 AT3G58660 348 / 9e-117 Ribosomal protein L1p/L10e family (.1)
Potri.012G145000
[exp]
53 / 3e-08 AT3G58660 352 / 2e-118 Ribosomal protein L1p/L10e family (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026664
[exp]
333 / 2e-112 AT2G03510 537 / 0.0 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Lus10004648
[exp]
330 / 2e-111 AT2G03510 541 / 0.0 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Lus10020615
[exp]
307 / 1e-105 AT2G27530 313 / 1e-107 PIGGYBACK1, Ribosomal protein L1p/L10e family (.1.2)
Lus10036911
[exp]
306 / 3e-101 AT2G03530 575 / 0.0 ARABIDOPSIS THALIANA UREIDE PERMEASE 2, ureide permease 2 (.1.2)
Lus10005380
[exp]
46 / 1e-05 AT3G58660 354 / 1e-119 Ribosomal protein L1p/L10e family (.1)
Lus10024134
[exp]
46 / 1e-05 AT3G58660 351 / 2e-118 Ribosomal protein L1p/L10e family (.1)
Lus10004871
[exp]
0 / 1 AT2G27530 201 / 3e-92 PIGGYBACK1, Ribosomal protein L1p/L10e family (.1.2)
Lus10037074
[exp]
0 / 1 AT2G03590 575 / 0.0 ureide permease 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00687 Ribosomal_L1 Ribosomal protein L1p/L10e family
Representative CDS sequence
>Potri.004G202766.1 pacid=42795231 polypeptide=Potri.004G202766.1.p locus=Potri.004G202766 ID=Potri.004G202766.1.v4.1 annot-version=v4.1
ATGAGTTATCTTGCGGGTGATACAATTCGTGAAGCTGTTACAACTATAAAAAATGGTGTGAACGATAAACCACGCAAATTCGTTCAGACTATTGAGCTAC
AGATTGGTTTGAAAAACTATGACCCCCAGAAGGACAAGAGGTTCAGTGGCTCTGTTAAGCTGCCACACATACCCCGCCCGAAAATGAAGGTCTGCATGCT
TGGAGATGCTCAGCATGTGGAGGAGGCAGAGTCAATAAGCTTGCAATGGATGGATGTTGAAGCACTGAAGAAGCTGAACAAAAACAAGAAATTGGTGAAG
AAGCTTTCAAAACAGTACCATGCCTTTTTGGCATCAGAGTCCGTCATCAAGCAGATTCCCCGTCTTTTAGGCCCTGGCCTCAACAAGGCAGGAAAGTTCC
CAACCCTTGTGACTCATCAAGAGTCGCTAGAGTCTAAGGTCAACGAGATCAAGGCAACCGTCAAGTTTCAATTGAAGAAAGTGCTGTGCATGGGTGTTGC
TGTTGGTAACTGCGGTATGGAGGACAAGCAGATCTTCCAGAATGTGCAGATGAGTGTCAATTTCCTTGTCTCACTTTTGAAGAAGAATTGGCAAAATGTG
AAGTCCCTGCACCTAAAGAGTACCATGGGAACACCAGTCCGCCTCTACTAA
AA sequence
>Potri.004G202766.1 pacid=42795231 polypeptide=Potri.004G202766.1.p locus=Potri.004G202766 ID=Potri.004G202766.1.v4.1 annot-version=v4.1
MSYLAGDTIREAVTTIKNGVNDKPRKFVQTIELQIGLKNYDPQKDKRFSGSVKLPHIPRPKMKVCMLGDAQHVEEAESISLQWMDVEALKKLNKNKKLVK
KLSKQYHAFLASESVIKQIPRLLGPGLNKAGKFPTLVTHQESLESKVNEIKATVKFQLKKVLCMGVAVGNCGMEDKQIFQNVQMSVNFLVSLLKKNWQNV
KSLHLKSTMGTPVRLY

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G08360 Ribosomal protein L1p/L10e fam... Potri.004G202766
[exp]
0 1
AT2G17270 PHT3;3 phosphate transporter 3;3 (.1) Potri.005G098800
[exp]
1.73 0.7181
AT5G20180 Ribosomal protein L36 (.1.2) Potri.006G069000
[exp]
3.46 0.7094
AT1G79650 AtAO1, RAD23B, ... RADIATION SENSITIVE23B, Arabid... Potri.003G186600
[exp]
5.91 0.7147 RAD23.2
AT3G10860 Cytochrome b-c1 complex, subun... Potri.013G159700
[exp]
6.32 0.7148
AT4G36130 Ribosomal protein L2 family (.... Potri.007G013000
[exp]
8.60 0.7244
AT1G10865 unknown protein Potri.008G010300
[exp]
8.94 0.6961
AT2G34480 Ribosomal protein L18ae/LX fam... Potri.004G063300
[exp]
13.22 0.7055 RPL18.6
AT3G06700 Ribosomal L29e protein family ... Potri.002G196800
[exp]
14.14 0.7048
AT1G16470 PAB1 proteasome subunit PAB1 (.1.2) Potri.012G123550
[exp]
14.86 0.6594
AT5G59240 Ribosomal protein S8e family p... Potri.001G360500
[exp]
19.07 0.6876

Potri.004G202766 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.