Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G50360 58 / 6e-11 CEN1, ATCEN2 CENTRIN 1, centrin2 (.1) AT5G12180 58 / 3e-10 CPK17 calcium-dependent protein kinase 17 (.1) AT5G19360 57 / 7e-10 CPK34 calcium-dependent protein kinase 34 (.1) AT4G04740 56 / 2e-09 CPK23, ATCPK23 calcium-dependent protein kinase 23 (.1.2) AT1G50700 55 / 3e-09 CPK33 calcium-dependent protein kinase 33 (.1) AT4G04720 54 / 7e-09 CPK21 calcium-dependent protein kinase 21 (.1) AT4G04700 53 / 1e-08 CPK27 calcium-dependent protein kinase 27 (.1) AT4G04695 53 / 2e-08 CPK31 calcium-dependent protein kinase 31 (.1) AT3G51850 52 / 2e-08 CPK13 calcium-dependent protein kinase 13 (.1) AT4G21940 52 / 3e-08 CPK15 calcium-dependent protein kinase 15 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G165700 [exp] 322 / 1e-114 AT5G04870 57 / 8e-10 calcium dependent protein kinase 1 (.1) Potri.009G069200 [exp] 61 / 5e-11 AT5G12180 914 / 0.0 calcium-dependent protein kinase 17 (.1) Potri.006G101300 [exp] 58 / 4e-10 AT3G51850 977 / 0.0 calcium-dependent protein kinase 13 (.1) Potri.003G134000 [exp] 57 / 6e-10 AT4G23650 776 / 0.0 Calcium dependent protein kinase 3, calcium-dependent protein kinase 6 (.1) Potri.001G097400 [exp] 57 / 7e-10 AT4G23650 781 / 0.0 Calcium dependent protein kinase 3, calcium-dependent protein kinase 6 (.1) Potri.001G274700 [exp] 56 / 2e-09 AT5G12180 909 / 0.0 calcium-dependent protein kinase 17 (.1) Potri.016G117200 [exp] 56 / 2e-09 AT3G51850 982 / 0.0 calcium-dependent protein kinase 13 (.1) Potri.005G138000 [exp] 53 / 5e-09 AT3G50360 275 / 4e-96 CENTRIN 1, centrin2 (.1) Potri.015G066200 [exp] 51 / 6e-08 AT1G74740 918 / 0.0 CALCIUM-DEPENDENT PROTEIN KINASE 1A, calcium-dependent protein kinase 30 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022624 [exp] 287 / 1e-100 AT4G04740 53 / 1e-08 calcium-dependent protein kinase 23 (.1.2) Lus10003320 [exp] 285 / 9e-100 AT3G50360 54 / 1e-08 CENTRIN 1, centrin2 (.1) Lus10002075 [exp] 61 / 3e-11 AT4G04720 536 / 0.0 calcium-dependent protein kinase 21 (.1) Lus10006777 [exp] 60 / 9e-11 AT4G04720 764 / 0.0 calcium-dependent protein kinase 21 (.1) Lus10038460 [exp] 59 / 2e-10 AT5G12180 916 / 0.0 calcium-dependent protein kinase 17 (.1) Lus10020046 [exp] 58 / 4e-10 AT4G04720 764 / 0.0 calcium-dependent protein kinase 21 (.1) Lus10036050 [exp] 58 / 5e-10 AT5G19360 908 / 0.0 calcium-dependent protein kinase 34 (.1) Lus10000889 [exp] 57 / 8e-10 AT5G12180 907 / 0.0 calcium-dependent protein kinase 17 (.1) Lus10017537 [exp] 55 / 5e-09 AT4G23650 803 / 0.0 Calcium dependent protein kinase 3, calcium-dependent protein kinase 6 (.1) Lus10021248 [exp] 54 / 6e-09 AT3G10660 809 / 0.0 calmodulin-domain protein kinase cdpk isoform 2 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0220 [poplar] [flax] EF_hand PF13499 [poplar] [flax] EF-hand_7 EF-hand domain pair
Representative CDS sequence Show only first row Show all	>Potri.004G204700.4 pacid=42796455 polypeptide=Potri.004G204700.4.p locus=Potri.004G204700 ID=Potri.004G204700.4.v4.1 annot-version=v4.1 ATGGAGAATAAGACGATACTAAGAGAATGGTTCGAGCGAGTTGACTCAGAGAAAACCGGAAACATCACTGCAACTCAGCTCAAGAGTGCTCTTGCTGTTG GTAACCTTGAATTCCCTCTCTCTGTTGTCCAACAAATGATCAGGATGTATGATTCTGATGGGAATGGAACTATGAGTTTTGATGAATTTGTTGGGCTAAA TAAATTTCTTTTAAAGGTTCAACAGGCATTCTCGGATCTCCAGAGGGGCCGTGGATATCTTGTGCCTGATGATGTATATGAGGGATTGGTGAAAATTGGT TTCTCACTGGACTCTCCTTCTTTTTACACAGTCTGTGAGAGCTTTGACCAGAAGAAGAACGGCAGAATTCATCTTGATGACTTCATATCTCTCTGCATCT TTGTACAGTCTGCTCGGAATCTTTTCAATTCTTTTGATACAACAAAACAAGGCAGAGTTACTCTTGATTTCAATCAGTTTGTGTATTGTACTGCGAATTG TAGAATATGA
AA sequence Show only first row Show all	>Potri.004G204700.4 pacid=42796455 polypeptide=Potri.004G204700.4.p locus=Potri.004G204700 ID=Potri.004G204700.4.v4.1 annot-version=v4.1 MENKTILREWFERVDSEKTGNITATQLKSALAVGNLEFPLSVVQQMIRMYDSDGNGTMSFDEFVGLNKFLLKVQQAFSDLQRGRGYLVPDDVYEGLVKIG FSLDSPSFYTVCESFDQKKNGRIHLDDFISLCIFVQSARNLFNSFDTTKQGRVTLDFNQFVYCTANCRI

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G12180		CPK17	calcium-dependent protein kina...		Potri.004G204700 [exp]	0	1
AT3G09640		APX1B, APX2	ASCORBATE PEROXIDASE 1B, ascor...		Potri.016G084800 [exp]	1.41	0.8140	APX1.1
AT1G73030		CHMP1A, VPS46.2	CHARGED MULTIVESICULAR BODY PR...		Potri.006G158538 [exp]	2.82	0.8172
AT1G73030		CHMP1A, VPS46.2	CHARGED MULTIVESICULAR BODY PR...		Potri.001G194400 [exp]	6.24	0.7868
AT4G12230			alpha/beta-Hydrolases superfam...		Potri.001G118000 [exp]	7.74	0.7110
AT3G15352		ATCOX17	ARABIDOPSIS THALIANA CYTOCHROM...		Potri.011G119000 [exp]	19.07	0.7120	ATCOX17.1
AT2G20142			Toll-Interleukin-Resistance (T...		Potri.018G023600 [exp]	19.89	0.7167
AT2G45720			ARM repeat superfamily protein...		Potri.002G153700 [exp]	22.44	0.6921
AT1G27000			Protein of unknown function (D...		Potri.008G149000 [exp]	23.23	0.7115
AT4G39235			unknown protein		Potri.002G057100 [exp]	23.49	0.6837
AT5G47760		ATPK5, ATPGLP2	2-phosphoglycolate phosphatase...		Potri.016G004200 [exp]	24.33	0.7413

Compare expression of checked genes

Potri.004G204700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.