Potri.004G206400 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G42000 69 / 1e-16 AtMT4a Arabidopsis thaliana metallothionein 4a, Plant EC metallothionein-like protein, family 15 (.1.2)
AT2G23240 68 / 1e-16 AtMT4b Arabidopsis thaliana metallothionein 4b, Plant EC metallothionein-like protein, family 15 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G167700 122 / 3e-38 AT2G23240 / Arabidopsis thaliana metallothionein 4b, Plant EC metallothionein-like protein, family 15 (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10022998 74 / 6e-19 AT2G42000 74 / 1e-18 Arabidopsis thaliana metallothionein 4a, Plant EC metallothionein-like protein, family 15 (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0461 Metallothionein PF02068 Metallothio_PEC Plant PEC family metallothionein
Representative CDS sequence
>Potri.004G206400.1 pacid=42794172 polypeptide=Potri.004G206400.1.p locus=Potri.004G206400 ID=Potri.004G206400.1.v4.1 annot-version=v4.1
ATGGCAGATACCAGAGGAGGTACCGTGGGTTGCAATGATGGGTGTGGATGTCCTGTTCCTTGCGCTGGTGGCACATCCTGCGGTTCAATGAAGGCCACAA
GCGGAGAGGGAGCTGGACACAACAAATGCTCGTGTGGCGAGCACTGTGGCTGCAATCCATGCACATGCCCTAGGAGCGTGGTGACTACTGGGGTGGGCAA
GGCCTACTGTAAGTGTGGTGCTGATTGTGCTTGTCCGACCTGCAGTTCTTGA
AA sequence
>Potri.004G206400.1 pacid=42794172 polypeptide=Potri.004G206400.1.p locus=Potri.004G206400 ID=Potri.004G206400.1.v4.1 annot-version=v4.1
MADTRGGTVGCNDGCGCPVPCAGGTSCGSMKATSGEGAGHNKCSCGEHCGCNPCTCPRSVVTTGVGKAYCKCGADCACPTCSS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G42000 AtMT4a Arabidopsis thaliana metalloth... Potri.004G206400 0 1
AT3G48460 GDSL-like Lipase/Acylhydrolase... Potri.012G093400 1.41 0.9922
AT5G42930 alpha/beta-Hydrolases superfam... Potri.014G027800 3.16 0.8914
Potri.001G006250 4.24 0.8845
AT4G34480 O-Glycosyl hydrolases family 1... Potri.009G115400 4.58 0.8636
AT2G16430 ATPAP10, PAP10 purple acid phosphatase 10 (.1... Potri.004G160100 24.49 0.8055 Pt-PAP.2
AT4G38380 MATE efflux family protein (.1... Potri.005G102800 27.92 0.8407
AT4G05530 SDRA, IBR1 SHORT-CHAIN DEHYDROGENASE/REDU... Potri.011G022400 28.77 0.7644
Potri.010G149600 49.37 0.7927
AT4G20970 bHLH bHLH162 basic helix-loop-helix (bHLH) ... Potri.019G034700 65.72 0.8014
AT3G18050 unknown protein Potri.012G049000 97.34 0.7901

Potri.004G206400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.