Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-XCP1.1
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G35350 543 / 0 XCP1 xylem cysteine peptidase 1 (.1.2) AT1G20850 509 / 0 XCP2 xylem cysteine peptidase 2 (.1) AT5G43060 368 / 2e-125 Granulin repeat cysteine protease family protein (.1) AT1G47128 364 / 5e-124 RD21A, RD21 RESPONSIVE TO DEHYDRATION 21A, responsive to dehydration 21, Granulin repeat cysteine protease family protein (.1) AT5G50260 347 / 8e-119 CEP1 cysteine endopeptidase 1, Cysteine proteinases superfamily protein (.1) AT3G19390 340 / 9e-115 Granulin repeat cysteine protease family protein (.1) AT1G09850 335 / 6e-113 XBCP3 xylem bark cysteine peptidase 3 (.1) AT3G48340 327 / 1e-110 CEP2 cysteine endopeptidase 2, Cysteine proteinases superfamily protein (.1) AT4G11320 322 / 1e-108 Papain family cysteine protease (.1) AT4G23520 321 / 2e-108 Cysteine proteinases superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G256000 [exp] 531 / 0 AT1G20850 539 / 0.0 xylem cysteine peptidase 2 (.1) Potri.002G005700 [exp] 526 / 0 AT1G20850 531 / 0.0 xylem cysteine peptidase 2 (.1) Potri.009G098100 [exp] 387 / 6e-133 AT1G47128 607 / 0.0 RESPONSIVE TO DEHYDRATION 21A, responsive to dehydration 21, Granulin repeat cysteine protease family protein (.1) Potri.014G024100 [exp] 379 / 1e-129 AT5G43060 646 / 0.0 Granulin repeat cysteine protease family protein (.1) Potri.001G302100 [exp] 377 / 1e-128 AT1G47128 598 / 0.0 RESPONSIVE TO DEHYDRATION 21A, responsive to dehydration 21, Granulin repeat cysteine protease family protein (.1) Potri.007G047600 [exp] 363 / 1e-124 AT5G43060 461 / 9e-162 Granulin repeat cysteine protease family protein (.1) Potri.005G141600 [exp] 353 / 7e-121 AT4G36880 437 / 1e-153 cysteine proteinase1 (.1) Potri.005G232900 [exp] 346 / 3e-117 AT1G09850 594 / 0.0 xylem bark cysteine peptidase 3 (.1) Potri.012G090900 [exp] 336 / 4e-114 AT5G50260 561 / 0.0 cysteine endopeptidase 1, Cysteine proteinases superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030722 [exp] 491 / 3e-175 AT4G35350 511 / 0.0 xylem cysteine peptidase 1 (.1.2) Lus10013204 [exp] 488 / 4e-174 AT1G20850 509 / 0.0 xylem cysteine peptidase 2 (.1) Lus10002827 [exp] 370 / 5e-126 AT1G47128 609 / 0.0 RESPONSIVE TO DEHYDRATION 21A, responsive to dehydration 21, Granulin repeat cysteine protease family protein (.1) Lus10014087 [exp] 370 / 5e-126 AT5G43060 622 / 0.0 Granulin repeat cysteine protease family protein (.1) Lus10024801 [exp] 369 / 8e-126 AT1G47128 633 / 0.0 RESPONSIVE TO DEHYDRATION 21A, responsive to dehydration 21, Granulin repeat cysteine protease family protein (.1) Lus10027877 [exp] 366 / 3e-124 AT5G43060 597 / 0.0 Granulin repeat cysteine protease family protein (.1) Lus10033040 [exp] 340 / 6e-116 AT5G50260 555 / 0.0 cysteine endopeptidase 1, Cysteine proteinases superfamily protein (.1) Lus10018083 [exp] 340 / 1e-115 AT5G50260 533 / 0.0 cysteine endopeptidase 1, Cysteine proteinases superfamily protein (.1) Lus10013674 [exp] 338 / 3e-115 AT5G50260 554 / 0.0 cysteine endopeptidase 1, Cysteine proteinases superfamily protein (.1) Lus10042078 [exp] 337 / 2e-114 AT5G50260 538 / 0.0 cysteine endopeptidase 1, Cysteine proteinases superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0125 [poplar] [flax] Peptidase_CA PF00112 [poplar] [flax] Peptidase_C1 Papain family cysteine protease CL0125 [poplar] [flax] PF08246 [poplar] [flax] Inhibitor_I29 Cathepsin propeptide inhibitor domain (I29)
Representative CDS sequence Show only first row Show all	>Potri.004G207600.1 pacid=42793894 polypeptide=Potri.004G207600.1.p locus=Potri.004G207600 ID=Potri.004G207600.1.v4.1 annot-version=v4.1 ATGGCACTCTCTGTTTTGAAGACTTCTTTTCTTACCTTCTTTGCGTCACTTTTCGTGTGTTCGGTTCTAGCCCACGACTTTTCAATCGTGGGTTACTCAC CAGAGCACTTGACTTCTGTTGACAAACTTGTTGAGCTATTCGAATCATGGATTTCTGGACATGGAAAAGCTTACAATAGTCTTGAAGAGAAGTTGCATAG GTTTGAGGTGTTCAAAGAAAACTTGAAGCACATTGACCAGAGAAACAAGGAGGTTACTAGCTACTGGCTTGGGTTGAATGAGTTTGCAGACCTGAGCCAT GAGGAGTTCAAGAGCAAGTTCTTAGGATTGTATCCCGAGTTTCCTAGGAAGAAGAGCTCCGATGACTTCAGTTACAGAGATGTGGTGGACTTGCCCAAAT CTATTGACTGGAGAAAGAAAGGAGCTGTTACTCCAGTCAAGAACCAAGGTTCTTGTGGCAGTTGTTGGGCATTCTCAACGGTTGCAGCTGTTGAAGGCAT AAACCAGATTGTCGCGGGAAATCTAACTTCATTGTCAGAACAACAGCTGATCGACTGCGACACAAGTTTCAACAATGGCTGTAATGGGGGCCTCATGGAT TATGCTTTCGAGTTCATAGTCAACAACGGTGGACTCCACAAAGAGGAAGACTACCCATATCTCATGGAGGAAGGCACTTGTGATGAAAAGAGGGAAGAAA TGGAGGTAGTAACTATTAGTGGTTACCATGACGTTCCACGAAATGACGAACAAAGCCTCTTGAAGGCACTAGCTCACCAGCCTCTCAGTGTTGCTATTGA CGCTTCTGGAAGAGATTTCCAATTCTATAGCGGGGGGGTATTCAGCGGACCTTGTGGAACAGATCTGGATCATGGAGTGGCGGCAGTAGGATATGGTTCA TCATCGGGGATAGATTATATCATCGTGAAGAATTCCTGGGGACCCAAGTGGGGTGAAAGGGGCTACCTACGGATGAAGAGAAATACAGGCAAACCTGAAG GGCTCTGTGGGATCAACAAAATGGCTTCATATCCCACCAAACAGAAGTGA
AA sequence Show only first row Show all	>Potri.004G207600.1 pacid=42793894 polypeptide=Potri.004G207600.1.p locus=Potri.004G207600 ID=Potri.004G207600.1.v4.1 annot-version=v4.1 MALSVLKTSFLTFFASLFVCSVLAHDFSIVGYSPEHLTSVDKLVELFESWISGHGKAYNSLEEKLHRFEVFKENLKHIDQRNKEVTSYWLGLNEFADLSH EEFKSKFLGLYPEFPRKKSSDDFSYRDVVDLPKSIDWRKKGAVTPVKNQGSCGSCWAFSTVAAVEGINQIVAGNLTSLSEQQLIDCDTSFNNGCNGGLMD YAFEFIVNNGGLHKEEDYPYLMEEGTCDEKREEMEVVTISGYHDVPRNDEQSLLKALAHQPLSVAIDASGRDFQFYSGGVFSGPCGTDLDHGVAAVGYGS SSGIDYIIVKNSWGPKWGERGYLRMKRNTGKPEGLCGINKMASYPTKQK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G35350		XCP1	xylem cysteine peptidase 1 (.1...		Potri.004G207600 [exp]	0	1	Pt-XCP1.1
AT5G43080		CYCA3;1	Cyclin A3;1 (.1)		Potri.008G008476 [exp]	2.00	0.7959
					Potri.016G052200 [exp]	3.74	0.7075
AT1G68330			unknown protein		Potri.010G122800 [exp]	4.47	0.7328
AT1G34575			FAD-binding Berberine family p...		Potri.011G158400 [exp]	6.70	0.7783
AT1G09890			Rhamnogalacturonate lyase fami...		Potri.002G110000 [exp]	7.21	0.7798
AT5G03260		LAC11	laccase 11 (.1)		Potri.007G023300 [exp]	12.00	0.7042
AT4G22120			ERD (early-responsive to dehyd...		Potri.011G009801 [exp]	12.00	0.7392
AT4G24430			Rhamnogalacturonate lyase fami...		Potri.002G110300 [exp]	14.31	0.7621
AT1G23460			Pectin lyase-like superfamily ...		Potri.011G159801 [exp]	15.42	0.7458
AT3G13050		AtNiaP	nicotinate transporter, Major ...		Potri.014G000800 [exp]	15.55	0.7275

Compare expression of checked genes

Potri.004G207600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.