Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G38160 481 / 4e-172 PDE191 pigment defective 191, Mitochondrial transcription termination factor family protein (.1.2.3) AT1G78930 129 / 5e-33 Mitochondrial transcription termination factor family protein (.1) AT2G21710 126 / 3e-32 EMB2219 embryo defective 2219, Mitochondrial transcription termination factor family protein (.1) AT4G02990 117 / 4e-29 RUG2, BSM RUGOSA 2, BELAYA SMERT, Mitochondrial transcription termination factor family protein (.1) AT2G44020 111 / 5e-27 Mitochondrial transcription termination factor family protein (.1) AT4G14605 98 / 2e-22 Mitochondrial transcription termination factor family protein (.1) AT2G03050 93 / 2e-21 SOLDAT10, EMB93 SINGLET OXYGEN-LINKED DEATH ACTIVATOR 10, EMBRYO DEFECTIVE 93, Mitochondrial transcription termination factor family protein (.1) AT5G55580 93 / 9e-21 Mitochondrial transcription termination factor family protein (.1) AT5G54180 87 / 1e-18 PTAC15 plastid transcriptionally active 15 (.1) AT2G34620 82 / 1e-17 Mitochondrial transcription termination factor family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G170300 [exp] 625 / 0 AT4G38160 479 / 8e-170 pigment defective 191, Mitochondrial transcription termination factor family protein (.1.2.3) Potri.007G001800 [exp] 138 / 2e-36 AT1G78930 633 / 0.0 Mitochondrial transcription termination factor family protein (.1) Potri.014G137400 [exp] 125 / 4e-32 AT4G02990 669 / 0.0 RUGOSA 2, BELAYA SMERT, Mitochondrial transcription termination factor family protein (.1) Potri.013G116700 [exp] 109 / 2e-26 AT2G44020 764 / 0.0 Mitochondrial transcription termination factor family protein (.1) Potri.001G361800 [exp] 104 / 1e-24 AT5G55580 584 / 0.0 Mitochondrial transcription termination factor family protein (.1) Potri.017G067600 [exp] 98 / 1e-22 AT4G14605 571 / 0.0 Mitochondrial transcription termination factor family protein (.1) Potri.009G116200 [exp] 96 / 1e-21 AT2G21710 748 / 0.0 embryo defective 2219, Mitochondrial transcription termination factor family protein (.1) Potri.016G072200 [exp] 86 / 1e-18 AT2G36000 280 / 1e-92 EMBRYO DEFECTIVE 3114, Mitochondrial transcription termination factor family protein (.1.2) Potri.006G205000 [exp] 80 / 1e-16 AT2G36000 284 / 2e-94 EMBRYO DEFECTIVE 3114, Mitochondrial transcription termination factor family protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013854 [exp] 526 / 0 AT4G38160 446 / 2e-158 pigment defective 191, Mitochondrial transcription termination factor family protein (.1.2.3) Lus10026571 [exp] 310 / 2e-105 AT4G38160 252 / 4e-83 pigment defective 191, Mitochondrial transcription termination factor family protein (.1.2.3) Lus10035714 [exp] 145 / 2e-39 AT1G78930 582 / 0.0 Mitochondrial transcription termination factor family protein (.1) Lus10014877 [exp] 128 / 5e-33 AT4G02990 665 / 0.0 RUGOSA 2, BELAYA SMERT, Mitochondrial transcription termination factor family protein (.1) Lus10004614 [exp] 120 / 4e-30 AT2G44020 707 / 0.0 Mitochondrial transcription termination factor family protein (.1) Lus10042322 [exp] 119 / 1e-29 AT2G21710 720 / 0.0 embryo defective 2219, Mitochondrial transcription termination factor family protein (.1) Lus10003775 [exp] 115 / 2e-28 AT5G55580 546 / 0.0 Mitochondrial transcription termination factor family protein (.1) Lus10022321 [exp] 109 / 2e-26 AT4G02990 540 / 0.0 RUGOSA 2, BELAYA SMERT, Mitochondrial transcription termination factor family protein (.1) Lus10004534 [exp] 103 / 3e-25 AT2G44020 477 / 7e-168 Mitochondrial transcription termination factor family protein (.1) Lus10037301 [exp] 99 / 1e-22 AT1G78930 508 / 4e-175 Mitochondrial transcription termination factor family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02536 [poplar] [flax] mTERF mTERF
Representative CDS sequence Show only first row Show all	>Potri.004G209400.1 pacid=42795130 polypeptide=Potri.004G209400.1.p locus=Potri.004G209400 ID=Potri.004G209400.1.v4.1 annot-version=v4.1 ATGGAAATGGTCACCGCTCAAAACGGTAATAGCAGCCTCCTCTGGTTCTTCAGGGATAGAGGTTTTGATGACAACACCATCCATGAAATGTTCCGAAAGT GCAAGCGCCTGCAAGACACCCAGAGGGATAGGGCATCTGAAAACTGGGCTTACCTGAAAACCATTGGCATTCAAGAGAGAAAGCTCCCTTCAATTATTTC AAAGTGTCCCAAAATACTAACTCTTGGTCTCAATGAGAAGCTCATCCCCATGGTTGAGTGTCTGGCTACCCTCGGTTCTAAACCTCGTGAAGTTGCTTCC GCCATCACCAAGTTCCCTCACATACTGTCTCATAGTGTTGAAGAGAAGCTCTGCCCCCTTTTGGCATTCTTTCAGGCAATAGGGGTCCCTGAAAAGCAAC TCGGCAGGATTTTATTGCTCAACCCAAGGCTCGTCAGCTACAGCATTGATTCCAAGCTCAAAGAAATTGTTGATTTTCTCGCATCTCTTGGCCTTACCAA AGATGGGATGATTGGTAAAGTCTTGGTGAAACACCCCTTTATAACAGGTTATAGCGTTGAAAAGAGGCTACGCCCCACTTCAGAGTTTCTCAAGTCAGTT GGACTGACAGAGCTGGATCTTCGAACAGTGGTCATGAACTTCCCTGAAGTTCTTTGTAGAGATGTCAACAAGATTCTGAAACCCAATTTTGCATATCTAA GGAGATGTGGATTTAATGATAGACAAATAGCAGCTTTGGTGACTGGTTATCCCCCTATTTTGATCAAGAGTGTCAAGAATTCACTGGAACCTCGTATCAA GTTCTTGGTGGAAGTAATGGGAAGGCAAATAGATGAAGTTGTTGATTACCCCAGCTTCTTTCAGCATGGTTTGAAGAAGACCTTGGAGTCAAGGCACAAA CTTTTGAAACAGAGGAAACTAGATTGTAGCTTGAGCGATATGCTAGGTTGTAATCAAAAGAAGTTCCTGATGAAGTATGCCTTGCTTCAAGGATCTGCTT GA
AA sequence Show only first row Show all	>Potri.004G209400.1 pacid=42795130 polypeptide=Potri.004G209400.1.p locus=Potri.004G209400 ID=Potri.004G209400.1.v4.1 annot-version=v4.1 MEMVTAQNGNSSLLWFFRDRGFDDNTIHEMFRKCKRLQDTQRDRASENWAYLKTIGIQERKLPSIISKCPKILTLGLNEKLIPMVECLATLGSKPREVAS AITKFPHILSHSVEEKLCPLLAFFQAIGVPEKQLGRILLLNPRLVSYSIDSKLKEIVDFLASLGLTKDGMIGKVLVKHPFITGYSVEKRLRPTSEFLKSV GLTELDLRTVVMNFPEVLCRDVNKILKPNFAYLRRCGFNDRQIAALVTGYPPILIKSVKNSLEPRIKFLVEVMGRQIDEVVDYPSFFQHGLKKTLESRHK LLKQRKLDCSLSDMLGCNQKKFLMKYALLQGSA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G38160		PDE191	pigment defective 191, Mitocho...		Potri.004G209400 [exp]	0	1
AT1G08540		ATSIG1, SIG1, S...	SIGMA FACTOR B, RNA POLYMERASE...		Potri.019G044200 [exp]	1.73	0.9609
AT1G14030			Rubisco methyltransferase fami...		Potri.008G090500 [exp]	2.00	0.9708	RBCMT.1
AT2G20725			CAAX amino terminal protease f...		Potri.019G101100 [exp]	4.79	0.9462
AT1G47480			alpha/beta-Hydrolases superfam...		Potri.009G104900 [exp]	5.74	0.9530
AT2G22650			FAD-dependent oxidoreductase f...		Potri.018G112600 [exp]	7.00	0.9380
AT2G23560		ATMES7	ARABIDOPSIS THALIANA METHYL ES...		Potri.007G036800 [exp]	8.60	0.9619
AT5G57030		LUT2	LUTEIN DEFICIENT 2, Lycopene b...		Potri.006G147300 [exp]	10.00	0.9558
AT3G58140			phenylalanyl-tRNA synthetase c...		Potri.013G105200 [exp]	14.00	0.9585
AT1G14270			CAAX amino terminal protease f...		Potri.008G147600 [exp]	14.69	0.9540
AT1G11870		AtSRS, OVA7	ovule abortion 7, Seryl-tRNA s...		Potri.002G100300 [exp]	15.19	0.9535

Compare expression of checked genes

Potri.004G209400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.