Potri.004G213101 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.004G213101.1 pacid=42795393 polypeptide=Potri.004G213101.1.p locus=Potri.004G213101 ID=Potri.004G213101.1.v4.1 annot-version=v4.1
ATGGACGCCAAGAAGGTTACTTCCTCGCTCTTAATAATCACATTGCTGGTAGAAATGGGTTTTGATGAAGTAGGAGCCAACGAAGCGGTAGATGAATTAT
TATTCAAAACTTGCATGGCTGTGTGCATGAAAGAAGATGGAGCTACTATTCCAATCTGTACAAAGAGCTGTGAGGAGGCGACCGAAATTGTCTCTAGAAA
TCCAGGCTTTCTTATGGGGTTAAGACTTAATAGGTTACTTTAA
AA sequence
>Potri.004G213101.1 pacid=42795393 polypeptide=Potri.004G213101.1.p locus=Potri.004G213101 ID=Potri.004G213101.1.v4.1 annot-version=v4.1
MDAKKVTSSLLIITLLVEMGFDEVGANEAVDELLFKTCMAVCMKEDGATIPICTKSCEEATEIVSRNPGFLMGLRLNRLL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.004G213101 0 1
AT2G13620 ATCHX15 CATION/H+ EXCHANGER 15, cation... Potri.007G102700 6.48 0.5663
AT5G26330 Cupredoxin superfamily protein... Potri.006G259000 10.53 0.5537
AT2G30300 Major facilitator superfamily ... Potri.013G084000 30.19 0.4519
AT4G22080 RHS14 root hair specific 14 (.1) Potri.004G007300 36.41 0.4609
AT5G47670 CCAAT NF-YB6, L1L "nuclear factor Y, subunit B6"... Potri.006G005000 37.78 0.4609
AT2G34610 unknown protein Potri.011G083600 38.06 0.4469
AT3G30383 Protein of unknown function (D... Potri.017G039150 44.89 0.4818
AT1G43730 RNA-directed DNA polymerase (r... Potri.004G000150 46.18 0.4350
AT5G13620 unknown protein Potri.008G045000 46.73 0.4473
AT3G02100 UDP-Glycosyltransferase superf... Potri.010G084900 56.00 0.4340

Potri.004G213101 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.