Potri.004G213900 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G008300 153 / 6e-50 ND /
Potri.010G226200 51 / 2e-09 ND /
Potri.008G036000 48 / 2e-08 ND /
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10021443 66 / 2e-15 ND /
Lus10016122 58 / 2e-11 AT4G24270 45 / 1e-05 EMBRYO DEFECTIVE 140 (.1.2)
PFAM info
Representative CDS sequence
>Potri.004G213900.1 pacid=42795716 polypeptide=Potri.004G213900.1.p locus=Potri.004G213900 ID=Potri.004G213900.1.v4.1 annot-version=v4.1
ATGAGAAGTACTAGCACTACCACCATGTTTTACATTTTGTTCATCTATTTCCTGCTGTCATCTAATTCTCTGGGGATCACCATGGCTGGACGTGACATCC
CCAAGCCCCCCTCTAGCGTTCCAAGCACCATGATGGCAGTGCCTTTAGATTCACAAGGTGAAGATCATGTCAGAATGAAGCCTCTTTTGAATCGCAAGCG
ACCTTTCTTCGGTGATCGTGATGTGAAAGGTTGCTTGCCAAAAGGTTATAGGCATTCATCGGCTCCAAGCAGATTTGTGAACAATCTGCCCCTTGTCTTA
TGCTCTAAGTTGCAGCCTTGA
AA sequence
>Potri.004G213900.1 pacid=42795716 polypeptide=Potri.004G213900.1.p locus=Potri.004G213900 ID=Potri.004G213900.1.v4.1 annot-version=v4.1
MRSTSTTTMFYILFIYFLLSSNSLGITMAGRDIPKPPSSVPSTMMAVPLDSQGEDHVRMKPLLNRKRPFFGDRDVKGCLPKGYRHSSAPSRFVNNLPLVL
CSKLQP

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.004G213900 0 1
AT1G29740 Leucine-rich repeat transmembr... Potri.011G072741 1.41 0.9792
AT5G43700 AUX_IAA IAA4, ATAUX2-11 indole-3-acetic acid inducible... Potri.005G218200 1.73 0.9732 Pt-AUX22.4
AT1G02205 CER1 ECERIFERUM 1, Fatty acid hydro... Potri.014G152900 4.00 0.9689
AT2G32390 GLR6, ATGLR3.5 glutamate receptor 3.5 (.1.2.... Potri.014G152400 4.47 0.9688
AT5G43700 AUX_IAA IAA4, ATAUX2-11 indole-3-acetic acid inducible... Potri.002G045000 6.08 0.9538 AUX22.5
AT1G08810 MYB ATMYB60 myb domain protein 60 (.1.2) Potri.013G067500 6.48 0.9684
AT5G10250 DOT3 DEFECTIVELY ORGANIZED TRIBUTAR... Potri.007G093000 8.48 0.9581
Potri.001G259904 8.66 0.9640
Potri.001G259220 16.24 0.9514
AT5G38610 Plant invertase/pectin methyle... Potri.003G086600 17.94 0.9507

Potri.004G213900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.