Plant FIBer expression Database

Potri.004G214966 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G08110 110 / 2e-32 lactoylglutathione lyase family protein / glyoxalase I family protein (.1.2.3.4)
AT1G67280 38 / 0.0004 Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G007200
[exp]
125 / 3e-37 AT1G08110 318 / 6e-111 lactoylglutathione lyase family protein / glyoxalase I family protein (.1.2.3.4)
Potri.004G013200
[exp]
40 / 4e-05 AT1G11840 496 / 8e-179 glyoxalase I homolog (.1.2.3.4.5.6)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10021429
[exp]
105 / 4e-30 AT1G08110 297 / 3e-104 lactoylglutathione lyase family protein / glyoxalase I family protein (.1.2.3.4)
Lus10016138
[exp]
104 / 3e-29 AT1G08110 302 / 2e-104 lactoylglutathione lyase family protein / glyoxalase I family protein (.1.2.3.4)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0104 Glyoxalase PF00903 Glyoxalase Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily
Representative CDS sequence
>Potri.004G214966.1 pacid=42794403 polypeptide=Potri.004G214966.1.p locus=Potri.004G214966 ID=Potri.004G214966.1.v4.1 annot-version=v4.1
ATGTATGTTACTGTATTTGTAAAGGATGATTATCCCAAGCAAGAAGTAACATTTACAGTTTCTGTTCGCATTTCAGGAAATATTGGTGTTACTGTTGATG
ATACATACAAGGCATGCGAGAGATTTGAACGCTTAGGTGTGGAGTTTATGAAAAAACCTAACGATGGAAAAATGAAAGGGATAGCATTCATCAAGGATCC
TGATGGCTATTGGACTGAGATCTTCGATCTCAAGACCATTGGAAAAGTAACTGAAACCGCTGCTTGA
AA sequence
>Potri.004G214966.1 pacid=42794403 polypeptide=Potri.004G214966.1.p locus=Potri.004G214966 ID=Potri.004G214966.1.v4.1 annot-version=v4.1
MYVTVFVKDDYPKQEVTFTVSVRISGNIGVTVDDTYKACERFERLGVEFMKKPNDGKMKGIAFIKDPDGYWTEIFDLKTIGKVTETAA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G08110 lactoylglutathione lyase famil... Potri.004G214966
[exp]
0 1
AT4G26270 PFK3 phosphofructokinase 3 (.1) Potri.006G235132
[exp]
1.41 0.8642
AT5G18020 SAUR-like auxin-responsive pro... Potri.004G166300
[exp]
4.00 0.8498
AT3G49800 BSD domain-containing protein ... Potri.014G008400
[exp]
11.48 0.8224
AT2G27230 bHLH LHW, bHLH156 LONESOME HIGHWAY, transcriptio... Potri.016G101801
[exp]
12.64 0.8143
AT4G30700 Pentatricopeptide repeat (PPR)... Potri.006G181800
[exp]
16.97 0.7628
AT1G33055 unknown protein Potri.011G149400
[exp]
18.97 0.8015
AT3G28470 MYB TDF1, ATMYB35 DEFECTIVE IN MERISTEM DEVELOPM... Potri.017G075000
[exp]
19.62 0.7869
AT1G14570 UBX domain-containing protein ... Potri.008G142800
[exp]
21.26 0.7429
AT5G15120 Protein of unknown function (D... Potri.013G064200
[exp]
31.43 0.7841
AT1G32560 AtLEA4-1 Late Embryogenesis Abundant 4-... Potri.003G090501
[exp]
33.94 0.6977

Potri.004G214966 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.