Potri.004G217300 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G22875 88 / 7e-25 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10037369 91 / 6e-26 AT5G22875 104 / 1e-31 unknown protein
Lus10041349 68 / 2e-16 AT2G27970 154 / 2e-50 CDK-subunit 2 (.1)
PFAM info
Representative CDS sequence
>Potri.004G217300.1 pacid=42796693 polypeptide=Potri.004G217300.1.p locus=Potri.004G217300 ID=Potri.004G217300.1.v4.1 annot-version=v4.1
ATGACCCGGACACGTAATGTCATTGTTGCCACTGGATTACTGGCTTTTGCTGCTGCGGGCTTGGCATTTCCCTTCTACATGGCATCATCCAGGGGCAAGC
CAGTGATTGACCCATCAAAGCCATTGCCACCACAGGCGACTTTCCGAGGGCCTTACATAAACACAGGTTCACGTGACATTGGACCTGATCCTGGGCCTTA
CCCAAAGAAGTAA
AA sequence
>Potri.004G217300.1 pacid=42796693 polypeptide=Potri.004G217300.1.p locus=Potri.004G217300 ID=Potri.004G217300.1.v4.1 annot-version=v4.1
MTRTRNVIVATGLLAFAAAGLAFPFYMASSRGKPVIDPSKPLPPQATFRGPYINTGSRDIGPDPGPYPKK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G22875 unknown protein Potri.004G217300 0 1
AT5G60335 Thioesterase superfamily prote... Potri.006G133800 3.46 0.8879
AT1G16080 unknown protein Potri.001G041140 6.48 0.8921
AT4G26055 unknown protein Potri.010G204200 6.48 0.8784
Potri.013G159101 7.74 0.8659
AT4G17760 damaged DNA binding;exodeoxyri... Potri.001G139100 9.48 0.8747
AT3G44380 Late embryogenesis abundant (L... Potri.001G218400 11.13 0.8932
AT5G17870 PSRP6 plastid-specific 50S ribosomal... Potri.002G112500 11.26 0.9019
AT4G29660 EMB2752 embryo defective 2752 (.1) Potri.012G001800 13.22 0.8674
AT1G48460 unknown protein Potri.014G038800 16.00 0.8901
AT3G23760 unknown protein Potri.001G068800 21.02 0.8749

Potri.004G217300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.