Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-RPS16.2
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G56940 188 / 7e-63 Ribosomal protein S16 family protein (.1) AT4G34620 125 / 5e-38 SSR16 small subunit ribosomal protein 16 (.1) ATCG00050 53 / 5e-10 ATCG00050.1, RPS16 ribosomal protein S16 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G128200 [exp] 120 / 3e-36 AT4G34620 139 / 6e-44 small subunit ribosomal protein 16 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014281 [exp] 199 / 8e-67 AT5G56940 210 / 2e-71 Ribosomal protein S16 family protein (.1) Lus10025984 [exp] 198 / 2e-66 AT5G56940 208 / 1e-70 Ribosomal protein S16 family protein (.1) Lus10025592 [exp] 119 / 8e-36 AT4G34620 137 / 2e-43 small subunit ribosomal protein 16 (.1) Lus10027058 [exp] 117 / 3e-35 AT4G34620 136 / 4e-43 small subunit ribosomal protein 16 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00886 [poplar] [flax] Ribosomal_S16 Ribosomal protein S16
Representative CDS sequence Show only first row Show all	>Potri.004G217400.1 pacid=42795009 polypeptide=Potri.004G217400.1.p locus=Potri.004G217400 ID=Potri.004G217400.1.v4.1 annot-version=v4.1 ATGGTGGTGAGGATCCGGTTGTCGAGATTCGGGTGCAGTAACAAGCCATTTTATCGGGTTATGGCTGCTGATAGCAGATCCCCGAGAGATGGCAAACATC TTGAAGTCCTTGGTTACTACAACCCGCTTCCTGGTCAAGATGGAGGCAAACGAATGGGTCTTAATTTTGAGAGAGTAAAGTATTGGTTGTCCGTCGGTGC TCAGCCCTCAGAACCTGTCCAACGCATTCTTTTCAGAGCAGGGGTACTACCTCCACCACCAATGATGGTAATGGGACGGAAGGGTGGTCCTCGTGACACA CGTCCAGTCGATCCAATGACAGGACGTTTTTTGAGTCCAGAGAAGTCACCTAGTTCTTCTCAATCAAATGCTAGTAAAAATGACACTGAAGCCGCTACAA CAACTGCGTGA
AA sequence Show only first row Show all	>Potri.004G217400.1 pacid=42795009 polypeptide=Potri.004G217400.1.p locus=Potri.004G217400 ID=Potri.004G217400.1.v4.1 annot-version=v4.1 MVVRIRLSRFGCSNKPFYRVMAADSRSPRDGKHLEVLGYYNPLPGQDGGKRMGLNFERVKYWLSVGAQPSEPVQRILFRAGVLPPPPMMVMGRKGGPRDT RPVDPMTGRFLSPEKSPSSSQSNASKNDTEAATTTA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G56940			Ribosomal protein S16 family p...		Potri.004G217400 [exp]	0	1	Pt-RPS16.2
AT2G35795			Chaperone DnaJ-domain superfam...		Potri.006G131200 [exp]	1.41	0.8226
AT5G38890			Nucleic acid-binding, OB-fold-...		Potri.013G050400 [exp]	2.00	0.8084
AT2G20490		NOP10, EDA27	EMBRYO SAC DEVELOPMENT ARREST ...		Potri.002G036500 [exp]	5.00	0.7942
AT5G63670		SPT42	SPT4 homolog 2 (.1.2)		Potri.008G002400 [exp]	7.93	0.7417
AT1G73940			unknown protein		Potri.001G453400 [exp]	10.95	0.7614
AT5G12190			RNA-binding (RRM/RBD/RNP motif...		Potri.001G273200 [exp]	11.87	0.7071
AT1G22970			unknown protein		Potri.008G126400 [exp]	13.56	0.7071
AT2G20490		NOP10, EDA27	EMBRYO SAC DEVELOPMENT ARREST ...		Potri.005G226300 [exp]	15.49	0.7654
AT4G13850		ATGRP2, GR-RBP2	glycine rich protein 2, glycin...		Potri.017G059000 [exp]	16.49	0.7681
AT1G23860		SRZ21, SRZ-21, ...	RS-containing zinc finger prot...		Potri.019G050600 [exp]	19.74	0.8030

Compare expression of checked genes

Potri.004G217400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.