Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G27970 152 / 2e-50 CKS2 CDK-subunit 2 (.1) AT2G27960 145 / 3e-47 CKS1AT, CKS1 cyclin-dependent kinase-subunit 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G004000 [exp] 157 / 5e-52 AT2G27960 166 / 2e-55 cyclin-dependent kinase-subunit 1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041349 [exp] 154 / 5e-50 AT2G27970 154 / 2e-50 CDK-subunit 2 (.1) Lus10021405 [exp] 145 / 4e-47 AT2G27970 154 / 1e-50 CDK-subunit 2 (.1) Lus10016159 [exp] 145 / 4e-47 AT2G27970 154 / 1e-50 CDK-subunit 2 (.1) Lus10036579 [exp] 91 / 7e-24 AT2G27970 86 / 2e-21 CDK-subunit 2 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01111 [poplar] [flax] CKS Cyclin-dependent kinase regulatory subunit
Representative CDS sequence Show only first row Show all	>Potri.004G217500.2 pacid=42795551 polypeptide=Potri.004G217500.2.p locus=Potri.004G217500 ID=Potri.004G217500.2.v4.1 annot-version=v4.1 ATGGGTCAGATCCAGTACTCCGAGAAGTATTTAGATGATACTTTTGAGTACAGGCATGTGGTGCTTCCTCCTGAAGTCGCCAAACTTCTCATTAAGAATC GCCTTCTCTCTGAAAATGAGTGGCGAGCGATTGGAGTTCAGCAGAGCCGAGGGTGGGTCCATTATGCGATTCATCGCCCGGAGCCACACATCATGCTGTT CAGGAGGCCTTTGAATTATCAGCAGCAGCAGGATCAAGCTCTTGTCAAGTGA
AA sequence Show only first row Show all	>Potri.004G217500.2 pacid=42795551 polypeptide=Potri.004G217500.2.p locus=Potri.004G217500 ID=Potri.004G217500.2.v4.1 annot-version=v4.1 MGQIQYSEKYLDDTFEYRHVVLPPEVAKLLIKNRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNYQQQQDQALVK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G27970		CKS2	CDK-subunit 2 (.1)		Potri.004G217500 [exp]	0	1
AT1G49410		TOM6	translocase of the outer mitoc...		Potri.009G110100 [exp]	3.16	0.8174
AT1G27435			unknown protein		Potri.001G325000 [exp]	4.89	0.8046
AT4G33865			Ribosomal protein S14p/S29e fa...		Potri.001G295902 [exp]	11.13	0.8021
AT1G51060		HTA10	histone H2A 10 (.1)		Potri.011G131400 [exp]	12.40	0.7653	HTA901
AT4G29830		VIP3	vernalization independence 3, ...		Potri.006G145800 [exp]	12.72	0.7892
AT1G73177		APC13, BNS	anaphase-promoting complex 13,...		Potri.004G058400 [exp]	15.00	0.8000
AT1G07790		HTB1	Histone superfamily protein (....		Potri.008G029900 [exp]	15.36	0.7359
AT5G43970		ATTOM22-V, TOM2...	TRANSLOCASE OUTER MITOCHONDRIA...		Potri.014G192601 [exp]	16.79	0.7957
AT3G07230			wound-responsive protein-relat...		Potri.002G246300 [exp]	18.13	0.7921
AT5G14105			unknown protein		Potri.001G328100 [exp]	20.12	0.7799

Compare expression of checked genes

Potri.004G217500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.