Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G13260 44 / 7e-06 AP2_ERF EDF4, RAV1 ETHYLENE RESPONSE DNA BINDING FACTOR 4, related to ABI3/VP1 1 (.1) AT3G25730 42 / 5e-05 AP2_ERF EDF3 ethylene response DNA binding factor 3 (.1) AT1G51120 42 / 5e-05 AP2_ERF AP2/B3 transcription factor family protein (.1) AT1G68840 41 / 8e-05 AP2_ERF EDF2, RAV2, RAP2.8, TEM2, AtRAV2 TEMPRANILLO 2, RELATED TO AP2 8, ETHYLENE RESPONSE DNA BINDING FACTOR 2, related to ABI3/VP1 2 (.1.2) AT2G46870 40 / 0.0001 B3 NGA1 NGATHA1, AP2/B3-like transcriptional factor family protein (.1) AT1G35520 39 / 0.0005 ARF ARF15 auxin response factor 15 (.1) AT2G36080 38 / 0.0005 B3 ABS2, NGAL1 AP2/B3-like transcriptional factor family protein (.1.2) AT4G01500 38 / 0.0009 B3 NGA4 NGATHA4, AP2/B3-like transcriptional factor family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G011132 [exp] 178 / 5e-59 AT1G68840 44 / 7e-06 TEMPRANILLO 2, RELATED TO AP2 8, ETHYLENE RESPONSE DNA BINDING FACTOR 2, related to ABI3/VP1 2 (.1.2) Potri.004G220100 [exp] 174 / 2e-57 AT1G35520 44 / 6e-06 auxin response factor 15 (.1) Potri.003G011066 [exp] 169 / 1e-55 AT1G35240 43 / 2e-05 auxin response factor 20 (.1) Potri.003G010700 [exp] 168 / 3e-55 AT1G68840 55 / 1e-09 TEMPRANILLO 2, RELATED TO AP2 8, ETHYLENE RESPONSE DNA BINDING FACTOR 2, related to ABI3/VP1 2 (.1.2) Potri.004G219900 [exp] 146 / 2e-46 AT3G53310 / AP2/B3-like transcriptional factor family protein (.1) Potri.004G219800 [exp] 133 / 3e-41 AT3G53310 / AP2/B3-like transcriptional factor family protein (.1) Potri.004G219700 [exp] 130 / 7e-40 AT1G13260 41 / 6e-05 ETHYLENE RESPONSE DNA BINDING FACTOR 4, related to ABI3/VP1 1 (.1) Potri.004G221300 [exp] 88 / 4e-23 AT4G01500 48 / 4e-07 NGATHA4, AP2/B3-like transcriptional factor family protein (.1) Potri.015G015275 [exp] 87 / 5e-23 AT4G01500 44 / 4e-06 NGATHA4, AP2/B3-like transcriptional factor family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030240 [exp] 48 / 5e-07 AT2G46530 381 / 1e-126 auxin response factor 11 (.1.2.3) Lus10041340 [exp] 45 / 3e-06 AT3G61830 370 / 2e-122 auxin response factor 18 (.1) Lus10021326 [exp] 41 / 9e-05 AT5G06250 202 / 2e-63 AP2/B3-like transcriptional factor family protein (.1.2) Lus10040403 [exp] 40 / 0.0002 AT4G30080 625 / 0.0 auxin response factor 16 (.1) Lus10005930 [exp] 40 / 0.0002 AT5G62000 361 / 2e-112 ORESARA 14, HLS1 SUPPRESSOR, ARF1-BINDING PROTEIN, auxin response factor 2 (.1.2.3.4) Lus10040906 [exp] 39 / 0.0005 AT5G62000 367 / 2e-114 ORESARA 14, HLS1 SUPPRESSOR, ARF1-BINDING PROTEIN, auxin response factor 2 (.1.2.3.4) Lus10041487 [exp] 39 / 0.0005 AT1G13260 416 / 8e-146 ETHYLENE RESPONSE DNA BINDING FACTOR 4, related to ABI3/VP1 1 (.1) Lus10023519 [exp] 39 / 0.0007 AT4G30080 622 / 0.0 auxin response factor 16 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0405 [poplar] [flax] DNA_b-psBarrel PF02362 [poplar] [flax] B3 B3 DNA binding domain
Representative CDS sequence Show only first row Show all	>Potri.004G219450.1 pacid=42795749 polypeptide=Potri.004G219450.1.p locus=Potri.004G219450 ID=Potri.004G219450.1.v4.1 annot-version=v4.1 ATGCTAGGATCTCCCATACCTATCAATATGCCAAAAAAGCTATTCAAAAAGACACTATCAAAGACTGACATTGATTATAGAATGACAATTCCAATGGATA GCCTCTCCGCTTTCCAAATCCCAAAAGGAAAATACTCGAAAGAAGTTGCTGTCTTCGACATCGATGGTCGTCGATGGAGGTTCCGGTGTTCCACGAGAAG AAAAGATCCCCACCCCAAACCAGTCCTCTCTTCAGGCTGGATTAAGTTTGTCAAAAACAGGTGTCTCAAGGAAGGCGATGAAGTCATCTTTTCTGTCGCG GACAATGATGGAGCTGAGGGTCTGCAATTCGGAATTCAAGCACGGAAAAAACTCAAGTTACTCGGTCAAGAGTTTTGGGTAGACCCTCTTTGA
AA sequence Show only first row Show all	>Potri.004G219450.1 pacid=42795749 polypeptide=Potri.004G219450.1.p locus=Potri.004G219450 ID=Potri.004G219450.1.v4.1 annot-version=v4.1 MLGSPIPINMPKKLFKKTLSKTDIDYRMTIPMDSLSAFQIPKGKYSKEVAVFDIDGRRWRFRCSTRRKDPHPKPVLSSGWIKFVKNRCLKEGDEVIFSVA DNDGAEGLQFGIQARKKLKLLGQEFWVDPL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G13260	AP2_ERF	EDF4, RAV1	ETHYLENE RESPONSE DNA BINDING ...		Potri.004G219450 [exp]	0	1
AT1G68840	AP2_ERF	EDF2, RAV2, RAP...	TEMPRANILLO 2, RELATED TO AP2 ...		Potri.003G010700 [exp]	2.00	0.9973
AT4G01500	B3	NGA4	NGATHA4, AP2/B3-like transcrip...		Potri.004G221300 [exp]	8.66	0.9952
AT4G14746			unknown protein		Potri.013G039300 [exp]	9.16	0.9946	Pt-MTN26.2
AT3G53310	B3	REM20	AP2/B3-like transcriptional fa...		Potri.003G011200 [exp]	13.92	0.9900
AT3G12910	NAC		NAC (No Apical Meristem) domai...		Potri.005G098000 [exp]	14.14	0.9951	NAC077
					Potri.011G005500 [exp]	19.10	0.9948
					Potri.011G005400 [exp]	19.74	0.9947
AT4G39230			NmrA-like negative transcripti...		Potri.011G168400 [exp]	20.19	0.9892
AT5G06740			Concanavalin A-like lectin pro...		Potri.004G209300 [exp]	21.93	0.9942
AT2G03550			alpha/beta-Hydrolases superfam...		Potri.009G104100 [exp]	23.23	0.9906

Compare expression of checked genes

Potri.004G219450 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.