Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G26790 40 / 0.0001 B3 FUS3 FUSCA 3, AP2/B3-like transcriptional factor family protein (.1) AT1G01030 39 / 0.0002 B3 NGA3 NGATHA3, AP2/B3-like transcriptional factor family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G220300 [exp] 216 / 2e-74 AT3G26790 42 / 3e-05 FUSCA 3, AP2/B3-like transcriptional factor family protein (.1) Potri.003G010800 [exp] 157 / 5e-51 ND / Potri.003G011000 [exp] 147 / 3e-47 ND / Potri.004G220000 [exp] 122 / 2e-37 AT3G53310 / AP2/B3-like transcriptional factor family protein (.1) Potri.003G025350 [exp] 83 / 1e-21 ND / Potri.015G015800 [exp] 81 / 6e-21 AT1G13260 44 / 7e-06 ETHYLENE RESPONSE DNA BINDING FACTOR 4, related to ABI3/VP1 1 (.1) Potri.014G068000 [exp] 77 / 2e-19 AT1G68840 47 / 5e-07 TEMPRANILLO 2, RELATED TO AP2 8, ETHYLENE RESPONSE DNA BINDING FACTOR 2, related to ABI3/VP1 2 (.1.2) Potri.007G099100 [exp] 74 / 3e-18 AT1G25560 42 / 4e-05 TEMPRANILLO 1, ETHYLENE RESPONSE DNA BINDING FACTOR 1, AP2/B3 transcription factor family protein (.1) Potri.012G013501 [exp] 73 / 1e-17 AT4G01500 48 / 3e-07 NGATHA4, AP2/B3-like transcriptional factor family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021707 [exp] 40 / 0.0001 AT1G13260 369 / 1e-127 ETHYLENE RESPONSE DNA BINDING FACTOR 4, related to ABI3/VP1 1 (.1) Lus10035059 [exp] 39 / 0.0003 AT1G13260 250 / 2e-96 ETHYLENE RESPONSE DNA BINDING FACTOR 4, related to ABI3/VP1 1 (.1) Lus10021326 [exp] 39 / 0.0004 AT5G06250 202 / 2e-63 AP2/B3-like transcriptional factor family protein (.1.2) Lus10021006 [exp] 37 / 0.0008 AT1G49480 138 / 5e-42 related to vernalization1 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0405 [poplar] [flax] DNA_b-psBarrel PF02362 [poplar] [flax] B3 B3 DNA binding domain
Representative CDS sequence Show only first row Show all	>Potri.004G219600.1 pacid=42794321 polypeptide=Potri.004G219600.1.p locus=Potri.004G219600 ID=Potri.004G219600.1.v4.1 annot-version=v4.1 ATGGAAAACTTCACAAAAAAACTCGACAGCACCGATGTTCAGAGAAGACTAACGCTTCCAGAAAATTGTCTAAAAGATTTCCCAAAAGACCATGAAGCAA ACTTGAAGTTCAAAGACGAGGAGGGGCAAGTGTGGACCTTTCGTTGTAGAGTGTCACCAGGAAGGAGTTCAAAACCAGCCCTTTCTGGGGACTGGTTTTC ATTTGTTCGTAAAAAGGGTCTCAGTACCGGCGACGTTATAGTAATCATCTCTGATAAAGAGAAGGATGTAGCGGCAGGAGAACATTTCAAAATCAAGATT AAGAAATCAGCTTCAACACATCATCAAAACTAG
AA sequence Show only first row Show all	>Potri.004G219600.1 pacid=42794321 polypeptide=Potri.004G219600.1.p locus=Potri.004G219600 ID=Potri.004G219600.1.v4.1 annot-version=v4.1 MENFTKKLDSTDVQRRLTLPENCLKDFPKDHEANLKFKDEEGQVWTFRCRVSPGRSSKPALSGDWFSFVRKKGLSTGDVIVIISDKEKDVAAGEHFKIKI KKSASTHHQN

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G53310	B3	REM20	AP2/B3-like transcriptional fa...		Potri.004G219600 [exp]	0	1
AT5G36930			Disease resistance protein (TI...		Potri.011G012000 [exp]	4.69	0.8621
AT4G31980			unknown protein		Potri.003G207802 [exp]	5.47	0.8467
AT2G20142			Toll-Interleukin-Resistance (T...		Potri.001G007501 [exp]	6.92	0.8357
AT4G35100		SIMIP, PIP3A, P...	PLASMA MEMBRANE INTRINSIC PROT...		Potri.005G109200 [exp]	7.00	0.8046	MDPIP1.5
AT4G31980			unknown protein		Potri.003G208600 [exp]	10.24	0.8183
AT1G69550			disease resistance protein (TI...		Potri.005G030318 [exp]	12.72	0.8110
AT5G01750			Protein of unknown function (D...		Potri.016G131701 [exp]	13.07	0.7781
AT1G02170		AtMCP1b, ATMC1,...	LSD ONE LIKE 3, ARABIDOPSIS TH...		Potri.012G112700 [exp]	13.41	0.7789
AT1G69550			disease resistance protein (TI...		Potri.005G031899 [exp]	15.23	0.8019
AT2G20142			Toll-Interleukin-Resistance (T...		Potri.005G030413 [exp]	18.46	0.7933

Compare expression of checked genes

Potri.004G219600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.