Potri.004G220250 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.004G220250.1 pacid=42796520 polypeptide=Potri.004G220250.1.p locus=Potri.004G220250 ID=Potri.004G220250.1.v4.1 annot-version=v4.1
ATGTTTCACCATCTTCACCTCTCAACACAGCCCCCACCCCCATCTTCACTCTCAACCTTTCTCGTCCATGTTTCTCAATCTTCACCTCTCAGCACAGCCC
CCCCTCCCATCTTCACTCTCAACCTTTCTCGTCCATGTTTCTCAATCTTCATCTCTCAGCACAGCCCCCCCTCCCATCTTCATCTCTCATCTCTCAACTG
TTCTCACAGCCCCCCATCTTCATCTCTCAACCTTTCTCACGGCCCCCCATCACAGCCCCCTATCTTCATCTCTCATCTCTCAACCTTTCTCACAGCCCCC
CCTCAACATCTTCATCTTCATCTCTCATCTCTCTCAACCTTTCGTTAA
AA sequence
>Potri.004G220250.1 pacid=42796520 polypeptide=Potri.004G220250.1.p locus=Potri.004G220250 ID=Potri.004G220250.1.v4.1 annot-version=v4.1
MFHHLHLSTQPPPPSSLSTFLVHVSQSSPLSTAPPPIFTLNLSRPCFSIFISQHSPPSHLHLSSLNCSHSPPSSSLNLSHGPPSQPPIFISHLSTFLTAP
PQHLHLHLSSLSTFR

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.004G220250 0 1
Potri.012G135500 6.32 0.8177
AT1G21980 ATPIPK1, ATPIP5... phosphatidylinositol-4-phospha... Potri.005G172800 36.74 0.7911 Pt-PIP5.1
AT5G50740 Heavy metal transport/detoxifi... Potri.015G099500 37.46 0.8315
Potri.013G064900 40.98 0.8223
AT5G36740 Acyl-CoA N-acyltransferase wit... Potri.002G051400 45.35 0.8282
ATCG00170 ATCG00170.1, RP... DNA-directed RNA polymerase fa... Potri.003G067266 47.24 0.8264
AT1G68300 Adenine nucleotide alpha hydro... Potri.008G121800 50.29 0.8009
AT3G54500 unknown protein Potri.003G200300 51.43 0.8239
ATCG00170 ATCG00170.1, RP... DNA-directed RNA polymerase fa... Potri.019G027720 61.43 0.8205
Potri.011G074501 66.67 0.8193

Potri.004G220250 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.