Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G77850 40 / 9e-05 ARF ARF17 auxin response factor 17 (.1) AT1G35520 39 / 0.0004 ARF ARF15 auxin response factor 15 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G220700 [exp] 244 / 1e-85 AT3G25730 44 / 7e-06 ethylene response DNA binding factor 3 (.1) Potri.004G220550 [exp] 244 / 1e-85 AT3G25730 44 / 7e-06 ethylene response DNA binding factor 3 (.1) Potri.003G010763 [exp] 193 / 3e-65 AT3G25730 42 / 4e-05 ethylene response DNA binding factor 3 (.1) Potri.003G011200 [exp] 157 / 6e-51 AT3G53310 / AP2/B3-like transcriptional factor family protein (.1) Potri.014G068000 [exp] 82 / 4e-21 AT1G68840 47 / 5e-07 TEMPRANILLO 2, RELATED TO AP2 8, ETHYLENE RESPONSE DNA BINDING FACTOR 2, related to ABI3/VP1 2 (.1.2) Potri.003G018400 [exp] 79 / 7e-20 ND / Potri.003G015900 [exp] 77 / 4e-19 AT3G53310 / AP2/B3-like transcriptional factor family protein (.1) Potri.014G067900 [exp] 76 / 6e-19 AT4G01500 42 / 2e-05 NGATHA4, AP2/B3-like transcriptional factor family protein (.1) Potri.003G017566 [exp] 74 / 4e-18 AT3G53310 / AP2/B3-like transcriptional factor family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030240 [exp] 49 / 2e-07 AT2G46530 381 / 1e-126 auxin response factor 11 (.1.2.3) Lus10041340 [exp] 40 / 0.0001 AT3G61830 370 / 2e-122 auxin response factor 18 (.1) Lus10024754 [exp] 40 / 0.0002 AT1G77850 505 / 1e-173 auxin response factor 17 (.1) Lus10024753 [exp] 39 / 0.0003 AT1G77850 494 / 2e-169 auxin response factor 17 (.1) Lus10009770 [exp] 39 / 0.0003 AT1G77850 496 / 4e-170 auxin response factor 17 (.1) Lus10036282 [exp] 38 / 0.0006 AT1G50680 268 / 2e-88 AP2/B3 transcription factor family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0405 [poplar] [flax] DNA_b-psBarrel PF02362 [poplar] [flax] B3 B3 DNA binding domain
Representative CDS sequence Show only first row Show all	>Potri.004G220400.2 pacid=42794528 polypeptide=Potri.004G220400.2.p locus=Potri.004G220400 ID=Potri.004G220400.2.v4.1 annot-version=v4.1 ATGGCATTAGTCTTTTCAAAGTTTCTAACTGCAGATGATATTGAGAATGGCTTGTCTATTCCTGGTTGTTCTCTTGGTCCATTACCATTCCAAGAAGGCC AATCGATGAACATGCATGTTCACGATGGTAATGGTCACGAATGGATCTTCTCTTGCACCATCAAGAGAAATGAGAGTATGGGACATTTTCTTTCTGTGGG CTGGAATAAATTTGTTCGTGAGAGGGATCTTCGAGTGGATGATAAGGTCACAATTCATGAGGAGGCCATGAAAAACCAAGCTATGGGAACATGGATCAAA GTGGAAGTGAAAAGAAAGATCAGATTGTTTGGTGAGGATGTTTGGGCTGATGTCTAA
AA sequence Show only first row Show all	>Potri.004G220400.2 pacid=42794528 polypeptide=Potri.004G220400.2.p locus=Potri.004G220400 ID=Potri.004G220400.2.v4.1 annot-version=v4.1 MALVFSKFLTADDIENGLSIPGCSLGPLPFQEGQSMNMHVHDGNGHEWIFSCTIKRNESMGHFLSVGWNKFVRERDLRVDDKVTIHEEAMKNQAMGTWIK VEVKRKIRLFGEDVWADV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G25730	AP2_ERF	EDF3	ethylene response DNA binding ...		Potri.004G220400 [exp]	0	1
AT3G25730	AP2_ERF	EDF3	ethylene response DNA binding ...		Potri.004G220700 [exp]	2.00	0.9718
AT3G25730	AP2_ERF	EDF3	ethylene response DNA binding ...		Potri.004G220550 [exp]	3.00	0.9870
AT2G35980		NHL10, YLS9, AT...	YELLOW-LEAF-SPECIFIC GENE 9, A...		Potri.006G204300 [exp]	4.47	0.9371	B13.1
AT2G24300			Calmodulin-binding protein (.1...		Potri.006G187900 [exp]	7.48	0.8913	CBP60.9
AT1G49850			RING/U-box superfamily protein...		Potri.009G091200 [exp]	8.24	0.8507
					Potri.017G077100 [exp]	9.16	0.8571
AT5G18150			Methyltransferase-related prot...		Potri.019G035000 [exp]	10.00	0.8470
AT5G48150	GRAS	PAT1	phytochrome a signal transduct...		Potri.001G409500 [exp]	10.39	0.8907
AT2G17290		ATCPK6, ATCDPK3...	calcium dependent protein kina...		Potri.009G168600 [exp]	10.95	0.8656	CDPK3.2
AT5G13160		PBS1	avrPphB susceptible 1, Protein...		Potri.003G166900 [exp]	11.61	0.8377	Pt-PBS1.1

Compare expression of checked genes

Potri.004G220400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.