Potri.004G220550 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G77850 40 / 9e-05 ARF ARF17 auxin response factor 17 (.1)
AT1G35520 39 / 0.0004 ARF ARF15 auxin response factor 15 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G220700 246 / 2e-86 AT3G25730 44 / 7e-06 ethylene response DNA binding factor 3 (.1)
Potri.004G220400 244 / 1e-85 AT3G25730 44 / 6e-06 ethylene response DNA binding factor 3 (.1)
Potri.003G010763 192 / 4e-65 AT3G25730 42 / 4e-05 ethylene response DNA binding factor 3 (.1)
Potri.003G011200 156 / 9e-51 AT3G53310 / AP2/B3-like transcriptional factor family protein (.1)
Potri.014G068000 82 / 3e-21 AT1G68840 47 / 5e-07 TEMPRANILLO 2, RELATED TO AP2 8, ETHYLENE RESPONSE DNA BINDING FACTOR 2, related to ABI3/VP1 2 (.1.2)
Potri.003G018400 79 / 7e-20 ND /
Potri.003G015900 77 / 2e-19 AT3G53310 / AP2/B3-like transcriptional factor family protein (.1)
Potri.014G067900 76 / 5e-19 AT4G01500 42 / 2e-05 NGATHA4, AP2/B3-like transcriptional factor family protein (.1)
Potri.003G017566 75 / 2e-18 AT3G53310 / AP2/B3-like transcriptional factor family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10030240 49 / 1e-07 AT2G46530 381 / 1e-126 auxin response factor 11 (.1.2.3)
Lus10041340 40 / 0.0001 AT3G61830 370 / 2e-122 auxin response factor 18 (.1)
Lus10024754 40 / 0.0002 AT1G77850 505 / 1e-173 auxin response factor 17 (.1)
Lus10024753 39 / 0.0003 AT1G77850 494 / 2e-169 auxin response factor 17 (.1)
Lus10009770 39 / 0.0003 AT1G77850 496 / 4e-170 auxin response factor 17 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0405 DNA_b-psBarrel PF02362 B3 B3 DNA binding domain
Representative CDS sequence
>Potri.004G220550.1 pacid=42795436 polypeptide=Potri.004G220550.1.p locus=Potri.004G220550 ID=Potri.004G220550.1.v4.1 annot-version=v4.1
ATGGCATTAGTCTTTTCAAAGTTTCTAACTGCAGATGATATTGAGAATGGCTTGTCTATTCCTGGTTGTTCTCTTGGTCCATTACCATTCCAAGAAGGCC
AATCGATGAACATGCATGTTCACGATGGTAATGGTCACGAATGGATCTTCTCTTGCACCATCAAGAGAAATGAGAGTACGGGACATTTTCTTTCTGTGGG
TTGGAATAAATTTGTTCGTGAGAGGGATCTTCGAGTGGATGATAAGGTCACAATTCATGAGGAGGCCATGAAAAACCAAGCTATGGGAACATGGATCAAA
GTGGAAGTGAAAAGAAAGATCAGATTGTTTGGTGAGGATGTTTGGGCTGATGTCTAA
AA sequence
>Potri.004G220550.1 pacid=42795436 polypeptide=Potri.004G220550.1.p locus=Potri.004G220550 ID=Potri.004G220550.1.v4.1 annot-version=v4.1
MALVFSKFLTADDIENGLSIPGCSLGPLPFQEGQSMNMHVHDGNGHEWIFSCTIKRNESTGHFLSVGWNKFVRERDLRVDDKVTIHEEAMKNQAMGTWIK
VEVKRKIRLFGEDVWADV

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G25730 AP2_ERF EDF3 ethylene response DNA binding ... Potri.004G220550 0 1
AT3G25730 AP2_ERF EDF3 ethylene response DNA binding ... Potri.004G220400 3.00 0.9870
AT2G35980 NHL10, YLS9, AT... YELLOW-LEAF-SPECIFIC GENE 9, A... Potri.006G204300 3.46 0.9399 B13.1
AT3G25730 AP2_ERF EDF3 ethylene response DNA binding ... Potri.004G220700 4.89 0.9295
AT5G48150 GRAS PAT1 phytochrome a signal transduct... Potri.001G409500 5.65 0.9116
AT2G24300 Calmodulin-binding protein (.1... Potri.006G187900 6.00 0.8993 CBP60.9
AT4G11170 Disease resistance protein (TI... Potri.019G095932 10.72 0.8827
AT4G16860 RPP5, RPP4 recognition of peronospora par... Potri.019G097300 13.19 0.8737
AT2G17290 ATCPK6, ATCDPK3... calcium dependent protein kina... Potri.009G168600 14.00 0.8737 CDPK3.2
AT5G54490 PBP1 pinoid-binding protein 1 (.1) Potri.013G151000 15.49 0.8930
AT3G44480 COG1, RPP10, RP... recognition of peronospora par... Potri.019G095866 20.14 0.8510

Potri.004G220550 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.