Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G09630 332 / 6e-117 ATRAB-A2A, ATRAB11C, ATRABA2A ARABIDOPSIS RAB GTPASE A2A, RAB GTPase 11C (.1) AT1G07410 289 / 5e-100 ATRAB-A2B, AtRABA2b ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) AT3G46830 275 / 2e-94 ATRAB-A2C, AtRab11A, AtRABA2c ARABIDOPSIS RAB GTPASE HOMOLOG A2C, RAB GTPase homolog A2C (.1) AT5G59150 270 / 8e-93 ATRAB-A2D, AtRABA2d ARABIDOPSIS RAB GTPASE HOMOLOG A2D, RAB GTPase homolog A2D (.1) AT1G16920 259 / 3e-88 ATRABA4B, RAB11, ATRABA1B RAB GTPase homolog A1B (.1) AT5G60860 259 / 3e-88 AtRABA1f RAB GTPase homolog A1F (.1) AT3G15060 253 / 5e-86 AtRABA1g RAB GTPase homolog A1G (.1) AT4G18430 252 / 2e-85 AtRABA1e RAB GTPase homolog A1E (.1) AT5G47960 250 / 9e-85 SMG1, AtRABA4c SMALL MOLECULAR WEIGHT G-PROTEIN 1, RAB GTPase homolog A4C (.1) AT1G28550 250 / 1e-84 AtRABA1i RAB GTPase homolog A1I (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G004100 [exp] 358 / 2e-127 AT1G09630 382 / 6e-137 ARABIDOPSIS RAB GTPASE A2A, RAB GTPase 11C (.1) Potri.006G000300 [exp] 288 / 1e-99 AT1G07410 400 / 4e-144 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Potri.010G197200 [exp] 285 / 1e-98 AT1G07410 370 / 3e-132 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Potri.008G061300 [exp] 283 / 1e-97 AT1G07410 367 / 9e-131 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Potri.016G000400 [exp] 278 / 7e-96 AT1G07410 380 / 4e-136 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Potri.011G070300 [exp] 259 / 4e-88 AT5G45750 392 / 1e-140 RAB GTPase homolog A1C (.1) Potri.019G092500 [exp] 258 / 5e-88 AT5G60860 419 / 2e-151 RAB GTPase homolog A1F (.1) Potri.004G061000 [exp] 254 / 1e-86 AT4G18800 392 / 9e-141 RAB GTPase homolog A1D (.1) Potri.013G123600 [exp] 254 / 3e-86 AT5G60860 419 / 2e-151 RAB GTPase homolog A1F (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041116 [exp] 318 / 3e-111 AT1G09630 395 / 4e-142 ARABIDOPSIS RAB GTPASE A2A, RAB GTPase 11C (.1) Lus10036441 [exp] 296 / 7e-103 AT1G09630 387 / 2e-138 ARABIDOPSIS RAB GTPASE A2A, RAB GTPase 11C (.1) Lus10001026 [exp] 283 / 7e-98 AT1G07410 366 / 2e-130 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Lus10016486 [exp] 277 / 3e-95 AT1G07410 396 / 1e-142 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Lus10040745 [exp] 276 / 6e-95 AT1G07410 394 / 7e-142 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Lus10040255 [exp] 275 / 2e-94 AT1G07410 363 / 2e-129 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Lus10004687 [exp] 274 / 3e-94 AT1G07410 363 / 2e-129 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Lus10015297 [exp] 263 / 8e-90 AT5G60860 428 / 6e-155 RAB GTPase homolog A1F (.1) Lus10025432 [exp] 261 / 8e-89 AT5G60860 422 / 1e-152 RAB GTPase homolog A1F (.1) Lus10002178 [exp] 259 / 2e-88 AT5G60860 423 / 4e-153 RAB GTPase homolog A1F (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [poplar] [flax] P-loop_NTPase PF08477 [poplar] [flax] Roc Ras of Complex, Roc, domain of DAPkinase
Representative CDS sequence Show only first row Show all	>Potri.004G226400.2 pacid=42794337 polypeptide=Potri.004G226400.2.p locus=Potri.004G226400 ID=Potri.004G226400.2.v4.1 annot-version=v4.1 GGCGAGGAGAGCAGACGAGGAATACGACTACCTGTTCAAGGTAGTATTAATCGGCGACTCAGGAGTAGGAAATCGAACCTCCTCTCCCGATTTACTCGCA ACGAGTTCTGTTTGGAGTCCAAGTCCACCATTGGCGTCGAATTCGCTACTCGCACTCTTCAAGTTGAAGGAAGGACTGTGAAAGCTCAGATATGGGACAC AGCTGGACAGGAGCGATACAGAGCAATCACCAGTGCCTACTATAGGGGTGCCCTTGGAGCTCTTCTTGTATATGATGTTACAAAGCCAACAACATTTGAA AATGTGAGTCGGTGGCTGAAGGAGCTGAGGGATCATGCGGATTCCAATATTGTGATCATGTTAATTGGGAACAAGACTGATCTGAAACATCTTCGAGCGG TTGCCACCGAGGATGCTCAAAGTTATGCAGAGAAAGAAGGGCTTGCATTTATAGAGACATCCGCTCTCGAAGCAACAAATGTTGAGAAGGCTTTCCAGAC AATTCTTTCAGAGATATATAGGATAGTTAGTAAGAAGTCACTTTCTTCAGAAGAGTCAGCACCTGCTAGTATCAAAGACGGGAAGACAATTGTAGTTGGA GGACCTGAGCCCGACACTAAAAAGACTTGCTGCTCTTCATCCTGA
AA sequence Show only first row Show all	>Potri.004G226400.2 pacid=42794337 polypeptide=Potri.004G226400.2.p locus=Potri.004G226400 ID=Potri.004G226400.2.v4.1 annot-version=v4.1 GEESRRGIRLPVQGSINRRLRSRKSNLLSRFTRNEFCLESKSTIGVEFATRTLQVEGRTVKAQIWDTAGQERYRAITSAYYRGALGALLVYDVTKPTTFE NVSRWLKELRDHADSNIVIMLIGNKTDLKHLRAVATEDAQSYAEKEGLAFIETSALEATNVEKAFQTILSEIYRIVSKKSLSSEESAPASIKDGKTIVVG GPEPDTKKTCCSSS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G09630		ATRAB-A2A, ATRA...	ARABIDOPSIS RAB GTPASE A2A, RA...		Potri.004G226400 [exp]	0	1
AT2G42310			unknown protein		Potri.016G051400 [exp]	1.00	0.9261
AT3G24350		ATSYP32, SYP32	syntaxin of plants 32 (.1.2)		Potri.006G157000 [exp]	7.14	0.9163
AT5G60460			Preprotein translocase Sec, Se...		Potri.009G012000 [exp]	11.48	0.8567
AT3G09880		ATB' BETA, ATB'...	Protein phosphatase 2A regulat...		Potri.006G122300 [exp]	17.32	0.8713
AT1G12310			Calcium-binding EF-hand family...		Potri.003G115000 [exp]	17.43	0.9012
AT1G34350			unknown protein		Potri.013G114800 [exp]	18.00	0.8956
AT2G47470		ATPDI11, ATPDIL...	UNFERTILIZED EMBRYO SAC 5, MAT...		Potri.002G198300 [exp]	21.97	0.8923
AT2G44680		CKB4	casein kinase II beta subunit...		Potri.014G052100 [exp]	22.13	0.8674	Pt-CKB3.1
AT1G51160			SNARE-like superfamily protein...		Potri.017G149900 [exp]	23.76	0.8974
AT5G63400		ADK1	adenylate kinase 1 (.1.2)		Potri.012G095300 [exp]	26.83	0.8920

Compare expression of checked genes

Potri.004G226400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.