Potri.004G227400 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G10240 83 / 3e-19 FAR1_related FRS11 FAR1-related sequence 11 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G227600 86 / 4e-20 AT1G10240 1199 / 0.0 FAR1-related sequence 11 (.1)
Potri.T171101 64 / 2e-12 AT1G10240 789 / 0.0 FAR1-related sequence 11 (.1)
Potri.008G108800 63 / 3e-12 AT1G10240 788 / 0.0 FAR1-related sequence 11 (.1)
Potri.002G199300 62 / 1e-11 AT1G10240 825 / 0.0 FAR1-related sequence 11 (.1)
Potri.014G167000 48 / 5e-07 AT5G28530 966 / 0.0 FAR1-related sequence 10 (.1)
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.004G227400.2 pacid=42794812 polypeptide=Potri.004G227400.2.p locus=Potri.004G227400 ID=Potri.004G227400.2.v4.1 annot-version=v4.1
ATGGCTAAGGAGATGCCTGCAATGAAACGTGCACTTTGTGAATGGATGATTGTAGAAGAGTTTCCATCCTGGTTTAAAGCTGATAATGAGTGGAAAGCAG
AGCTCTGTCGACTCTGTAATTTGGAGTCAACTGAGGACCTTGAACTGGGTTGGAGGGACATGGTCAATAAATTTGAACTGGTATGGAAGGGAGAGCCAAG
AAAGAAATACAAGAAACCAAGGCCAAAAGTGCGAGTGGGTCTGCCAAAGAAAATCTGTCAATATTTTGATGATCGGATTGGAAGGGAAGAAAATGAAGTC
ATTGTTGTTTTAGGAAGCAGAGGCGATTCGTTTTGCTTGGCTCTGAGATTTCTTAACAGCAATTGGGTGCAGAAACCTGTCAGCACTCACTTACAAGAGA
AAACCTGGAGAATAGCATCAATTAAAAAAAAAAAAGCTTCTTCCAGGCTCTAA
AA sequence
>Potri.004G227400.2 pacid=42794812 polypeptide=Potri.004G227400.2.p locus=Potri.004G227400 ID=Potri.004G227400.2.v4.1 annot-version=v4.1
MAKEMPAMKRALCEWMIVEEFPSWFKADNEWKAELCRLCNLESTEDLELGWRDMVNKFELVWKGEPRKKYKKPRPKVRVGLPKKICQYFDDRIGREENEV
IVVLGSRGDSFCLALRFLNSNWVQKPVSTHLQEKTWRIASIKKKKASSRL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G10240 FAR1_related FRS11 FAR1-related sequence 11 (.1) Potri.004G227400 0 1
AT3G28610 P-loop containing nucleoside t... Potri.012G072300 1.73 0.8586
AT3G60800 DHHC-type zinc finger family p... Potri.002G147300 3.16 0.8384
AT2G41900 C3HZnF OXS2 OXIDATIVE STRESS 2, CCCH-type ... Potri.006G053800 5.29 0.7945
AT2G35140 DCD (Development and Cell Deat... Potri.015G122300 9.48 0.8122
AT2G39750 S-adenosyl-L-methionine-depend... Potri.008G059500 10.58 0.8088
AT3G02970 EXL6 EXORDIUM like 6 (.1) Potri.013G080100 10.95 0.7836
AT5G62580 ARM repeat superfamily protein... Potri.012G074400 13.49 0.8097
Potri.001G400401 14.42 0.7956
AT4G16660 heat shock protein 70 (Hsp 70)... Potri.006G022100 14.86 0.7855
AT4G10150 RING/U-box superfamily protein... Potri.013G095100 17.02 0.8041

Potri.004G227400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.